Items where Subject is "B Philosophy. Psychology. Religion > BF Psychology"

Up a level
Export as [feed] Atom [feed] RSS 1.0 [feed] RSS 2.0
Group by: Creators | Item Type
Jump to: A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | Q | R | S | T | U | V | W | Y | Z
Number of items at this level: 1073.

A

AKBAR, FERDIAN ANTONY (2023) HUBUNGAN ANTARA REGULASI DIRI DAN STRES AKADEMIK PADA MAHASISWA FAKULTAS TEKNIK UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

AKBAR, NIGAR ILHAM (2020) HUBUNGAN ANTARA KONTROL DIRI DENGAN PERILAKU SEKSUAL PRANIKAH PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

AKROMI, THORIQ (2008) PENERIMAAN DIRI KAUM GAY DI KOTA SEMARANG (STUDI KASUS EMPAT ORANG GAY). Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

AMALIA, DINA MARSA (2023) HUBUNGAN ANTARA KEPUASAN KERJA DENGAN PRESTASI KERJA PADA KARYAWAN PT. SEGARA TERTA MAKMUR SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

AMALIA, WAODE RIZKI (2020) PERILAKU KONSUMTIF MAHASISWA FAKULTAS PSIKOLOGI UNISSULA DALAM MEMBELI SMARTPHONE TERBARU DITINJAU DARI KONFORMITAS. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

AMALIA, WAODE RIZKI (2019) PERILAKU KONSUMTIF MAHASISWA FAKULTAS PSIKOLOGI UNISSULA DALAM MEMBELI SMARTPHONE TERBARU DITINJAU DARI KONFORMITAS. Undergraduate thesis, Universitas Islam Sultan Agung.

AMIN, AL (2014) HUBUNGAN ANTARA KONFORMITAS KELOMPOK DENGAN KENAKALAN REMAJA PADA PELAJAR KELAS XI MA “X” JEPARA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

ANANDA NATASYA, LUSI (2023) HUBUNGAN ANTARA KONFLIK PERAN GANDA DENGAN KEHARMONISAN KELUARGA PADA IBU BEKERJA DI DESA BRANTAKSEKARJATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

ANGGARANI, DEIGITA (2023) HUBUNGAN ANTARA SIKAP TERHADAP PERINGATAN BAHAYA MEROKOK PADA KEMASAN ROKOK DENGAN INTENSI BERHENTI MEROKOK PADA MAHASISWA FAKULTAS X UNISSULA SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

ANNAJIHI, FAIQ (2023) HUBUNGAN ANTARA REFLEKSI DIRI DENGAN PENYESUAIAN AKADEMIK MAHASISWA PADA TRANSFORMASI PEMBELAJARAN DA.RING KE LU.RING. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

ARFI’AH, AMELIA (2023) HUBUNGAN KEPERCAYAAN DIRI AKADEMIK DENGAN MOTIVASI BELAJAR MATEMATIKA SISWA KELAS XI SMA NEGERI 10 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

ASHARI, RANI AISYAH (2019) PERBEDAAN TINGKAT KEMANDIRIAN BERDASARKAN JENIS POLA ASUH PADA MAHASISWA PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

ASMARA, ANDI (2003) HUBUNGAN KETRAMPILAN KERJA, MOTIVASI KERJA DENGAN PRODUKTIVITAS KERJA PADA KONVEKSI JEANS SANDANG RAKYAT KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

AURELIA, SHAFIRA ATHIA (2023) KEPRIBADIAN HARDINESS, JENIS PERSALINAN, DAN BABY BLUES SYNDROME: ANTARA KETERKAITAN DAN PERBEDAAN. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

AYU RAHMAWATI, DIAH (2011) HUBUNGAN ANTARA DUKUNGAN SOSIAL SUAMI DAN TIPE KEPRIBADIAN (EXTROVERT- INTROVERT) DENGAN STRES PERAN GANDA WANITA BEKERJA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ababiel, Jihan (2023) HUBUNGAN ANTARA KECERDASAN EMOSI DENGAN KECEMASAN SISWA MA NU MU’ALLIMAT KUDUS DALAM MENGHADAPI UJIAN AKHIR SEMESTER. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Abdurahman, Dwi (2022) HUBUNGAN ANTARA BIG FIVE PERSONALITY DENGAN KECANDUAN GAME ONLINE PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Abdussamad, Yudhi Prasetya Wicaksono (2017) HUBUNGAN ANTARA CITRA TUBUH DENGAN HARGA DIRI PADA REMAJA AKHIR PENYANDANG CACAT TUNA DAKSA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Adelia, Wiyola (2022) HUBUNGAN ANTARA KECERDASAN EMOSIONAL DENGAN KEMATANGAN KARIER PADA SISWA SMA “X” TEGAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Adeliamita, Reshinta (2019) COPING STRESS PADA ORANG TUA YANG MEMILIKI ANAK KETERLAMBATAN BICARA. Undergraduate thesis, Universitas Islam Sultan Agung.

Adhyaksy, Desca Erinanda (2020) HUBUNGAN ANTARA PENYESUAIAN DIRI DENGAN HOMESICKNESS PADA MAHASISWA RANTAU TAHUN PERTAMA DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Adhyaksy, Desca Erinanda (2019) HUBUNGAN ANTARA PENYESUAIAN DIRI DENGAN HOMESICKNESS PADA MAHASISWA RANTAU TAHUN PERTAMA DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Adi, Hermawan Sasono (2022) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN INTERAKSI SOSIAL PADA MAHASISWA JURUSAN PSIKOLOGI UNISSULA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Adib, Muhammad Al (2020) HUBUNGAN ANTARA EFIKASI DIRI DAN DUKUNGAN SOSIAL DENGAN KECEMASAN PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA DALAM MENGHADAPI BANJIR ROB DAN KEMACETAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Adib Zakaria, Mirza (2023) HUBUNGAN ANTARA LOCUS OF CONTROL DAN KOMITMEN KERJA DENGAN PERILAKU CYBERLOAFING PADA PEGAWAI NEGERI SIPIL (PNS) DINAS X KECAMATAN TAHUNAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Adila, Putri Qisthina (2017) HUBUNGAN ANTARA PERSEPSI TERHADAP LINGKUNGAN KERJA FISIK DENGAN KEPUASAN KERJA PADA PEGAWAI PT. PHAPROS Tbk SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Adinugraha, Ramadhan Rizky (2019) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KECEMASAN PADA MAHASISWA ANGKATAN 2015 YANG SEDANG MENGERJAKAN SKRIPSI DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Aeni, Qurrotul (2023) HUBUNGAN ANTARA PENYESUAIAN DIRI DENGAN INTERAKSI SOSIAL PADA MAHASISWA BARU FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG DI MASA TRANSISI PASCA PANDEMI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Affandi, Yusuf (2017) HUBUNGAN ANTARA KESADARAN LINGKUNGAN DENGAN SUBJECTIVE WELLBEING PADA MAHASISWA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Afiani, Syafrida Annisa (2023) HUBUNGAN ANTARA FEAR OF MISSING OUT DENGAN PERILAKU PHUBBING PADA MAHASISWA FAKULTAS ILMU PENDIDIKAN DAN HUMANIORA UNIVERSITAS X SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Afiary, Firnanda Putri (2023) HUBUNGAN ANTARA DIRECT ATTENTION FATIGUE TERHADAP MOTIVASI BELAJAR PADA SISWA SMA TANPA FASILITAS PENDINGIN RUANGAN. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Afiati, Annisa Nur (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL SUAMI DENGAN KECEMASAN PADA IBU TERHADAP MASA DEPAN ANAK BERKEBUTUHAN KHUSUS DI SLB MANUNGGAL SLAWI. Undergraduate thesis, Universitas Islam Sultan Agung.

Afiati, Annisa Nur (2020) HUBUNGAN ANTARA DUKUNGAN SOSIAL SUAMI DENGAN KECEMASAN PADA IBU TERHADAP MASA DEPAN ANAK BERKEBUTUHAN KHUSUS DI SLB MANUNGGAL SLAWI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Afifah, Shefi Lailul Nur (2023) HUBUNGAN TINGKAT KECERDASAN EMOSIONAL DAN KONTROL DIRI DENGAN TINGKAT AGRESIVITAS PADA REMAJA DI SEKOLAH SMK NEGERI 1 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Afnan, Khoirul (2010) HUBUNGAN ANTARA MOTIVASI KERJA DENGAN PRESTASI KERJA PEGAWAl NEGERI SIPIL DI BADAN KEPEGAWAIAN DAERAH DI KOTA SEMARANG JAWA TENGAH. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Agesti, Riana Citya (2022) HUBUNGAN ANTARA HARDINESS DENGAN BURNOUT PADA ANGGOTA POLISI POLRES DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

Agis, Izmiq Ilmania (2021) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KECEMASAN MENGHADAPI MUTASI PADA GURU PNS KKG GUGUS MUWARDI SALATIGA. Undergraduate thesis, Universitas Islam Sultan Agung.

Agustina, Elisa (2023) HUBUNGAN KECERDASAN EMOSI DAN STRATEGI COPING PADA SANTRI DI PONDOK PESANTREN AL – ITQON SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Agustina, Ika Deny (2020) HUBUNGAN ANTARA KONTROL DIRI DAN INTERAKSI TEMAN SEBAYA DENGAN KECERDASAN MORAL PADA SISWA SMA NEGERI 1 JAKENAN KABUPATEN PATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Agustriani, Isni (2014) HUBUNGAN KOMITMEN ORGANISASI DENGAN INTENSI TURNOVER PADA KARYAWAN MARKETING PENYEDIA LAYANAN TELEKOMUNIKASI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ahmad, Fiqran Kaisar (2016) HUBUNGAN ANTARA RASA SYUKUR DENGAN KEBAHAGIAAN PADA PEKERJA SEKS KOMERSIAL SUNAN KUNING KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Aini, Faradila (2015) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KEMATANGAN KARIR PADA SISWA SMA NEGERI 2 TEGAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Aisyah, Asti (2017) HUBUNGAN ANTARA RASA SYUKUR DENGAN KESEJAHTERAAN PSIKOLOGIS PADA GURU HONORER SEKOLAH DASAR (SD) DI UPT DISDIKPORA KECAMATAN PECANGAAN KABUPATEN JEPARA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Aji, Kukuh Septio (2020) DINAMIKA RAOS BEGJA PADA LANSIA: STUDI KASUS PADA PELAJAR KAWRUH JIWA. Undergraduate thesis, Universitas Islam Sultan Agung.

Ajijah, Ajijah (2023) HUBUNGAN ANTARA KESEPIAN DENGAN NOMOPHOBIA PADA MAHASISWA INDEKOS UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Akbar, Okky Nurrohim (2022) HUBUNGAN ANTARA MANAJEMEN WAKTU DAN PROKRASTINASI AKADEMIK PADA MAHASISWA YANG MENGIKUTI ORGANISASI UKM DI UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, Universitas Islam Sultan Agung.

Akhsan, Muhamad (2020) HUBUNGAN ANTARA RELIGIUSITAS DAN OPTIMISME DENGAN KESEJAHTERAAN PSIKOLOGIS PADA SISWI MA 2 FUTUHIYYAH DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Al-Rosyidi, Nur Generasi Hamzah (2019) HUBUNGAN ANTARA PROBLEM FOCUSED COPING DENGAN HARDINESS PADA MAHASISWA DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG YANG BEKERJA. Undergraduate thesis, Universitas Islam Sultan Agung.

Albani, Chaerandi Anggian Achmad (2020) HUBUNGAN ANTARA REGULASI DIRI DENGAN PROKRASTINASI DALAM MENYELESAIKAN SKRIPSI PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Albani, Chaerandi Anggian Achmad (2019) HUBUNGAN ANTARA REGULASI DIRI DENGAN PROKRASTINASI DALAM MENYELESAIKAN SKRIPSI PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Albara, Yusup (2014) HUBUNGAN ANTARA KONSEP DIRI DENGAN PENYESUAIAN SOSIAL DALAM LINGKUNGAN MASYARAKAT PADA WANITA PSK DI KABUPATEN PATI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Alfianti, Shahnaz Dwika (2023) KETERKAITAN ANTARA FULLFILLING DESIRE DAN GAYA HIDUP KELUARGA DENGAN PERILAKU KONSUMTIF PADA MAHASISWA PSIKOLOGI UNIVERSITAS X. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Alfianto, Yoga (2023) HUBUNGAN ANTARA KEMATANGAN EMOSI DENGAN PENYESUAIAN DIRI PADA ORANG TUA SISWA SELAMA PANDEMI COVID-19. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Alhakim, Adib Satrio (2021) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN KECEMASAN DALAM MENGERJAKAN SKRIPSI PADA MAHASISWA FAKULTAS EKONOMI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ali, Mochammad Haidar (2023) HUBUNGAN ANTARA GAYA HIDUP HEDONIS DENGAN PERILAKU KONSUMTIF PADA REMAJA YANG MENGGUNAKAN APLIKASI SHOPEE. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Alifia Salsabil, Ainaya (2023) HUBUNGAN ANTARA KESEPIAN DENGAN CELEBRITY WORSHIP PADA PENGGEMAR K-POP DI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Alifika, Nabila (2023) HUBUNGAN ANTARA PENERIMAAN DIRI DENGAN KECEMASAN MENGHADAPI MASA DEPAN PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Alija, Siti (2016) HUBUNGAN ANTARACITRA TUBUH DENGAN PERILAKU DIET PADA WANITA DEWASA AWALDI SANGGAR SENAMEM STUDIO SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Alim, Fahmi Nur (2020) HUBUNGAN ANTARA KEPRIBADIAN NARSISTIK DENGAN PERILAKU KONSUMTIF PADA SISWI SMK NEGERI 1 KOTA TEGAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Almaida, Risa (2022) PERAN INTERAKSI PERSONAL GURU-SISWA YANG OTORITATIF DAN DUKUNGAN AKADEMIK TEMAN SEBAYA TERHADAP KETERLIBATAN SISWA SMA DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Alvaini, Ade Ayu (2015) HUBUNGAN ANTARA KEMATANGAN EMOSI DAN KONFORMITAS DENGAN PERILAKU AGRESI PADA SISWA SMK X KOTA TEGAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Amadea .R., Ulimaz (2017) HUBUNGAN ANTARA PENYESUAIAN DIRI DAN STRES AKADEMIK PADA MAHASISWA FARMASI SEMESTER 2 UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Amalia, Anisah (2023) HUBUNGAN ANTARA KONSEP DIRI DENGAN CITRA TUBUH PADA REMAJA DI KOTA KUDUS YANG BERPROFESI SEBAGAI MODEL. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Amalia, Rifki (2021) HUBUNGAN PROKRASTINASI AKADEMIK DENGAN PERILAKU PLAGIARISME PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Amalia Putri, Devina (2022) HUBUNGAN ANTARA HARGA DIRI DAN KESADARAN DIRI DENGAN PRESENTASI DIRI PADA PENGGUNA MEDIA SOSIAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Amaliah, Nela (2017) HUBUNGAN ANTARA IDENTITAS SOSIAL DAN KONFORMITASDENGAN KECENDERUNGANAGRESIVITAS PADA SUPORTER SEPAKBOLA MADRIDISTA SEMARANG (MIRSE). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Amalina, Nabila Ila (2020) HUBUNGAN ANTARA KOMITMEN ORGANISASI DAN KEPUASAN KERJA TERHADAP ORGANIZATIONAL CITIZENSHIP BEHAVIOR (PERILAKU KEWARGANEGARAAN) PADA KARYAWAN PT MAFAHTEX KOTA PEKALONGAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Amalina, Nabila Ila (2019) HUBUNGAN ANTARA KOMITMEN ORGANISASI DAN KEPUASAN KERJA TERHADAP ORGANIZATIONAL CITIZENSHIP BEHAVIOR (PERILAKU KEWARGANEGARAAN) PADA KARYAWAN PT MAFAHTEX KOTA PEKALONGAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Amamlansyah, GG (2021) HUBUNGAN ANTARA REGULASI DIRI DAN KEPERCAYAAN DIRI AKADEMIK DENGAN PROKRASTIANSI AKADEMIK MAHASISWA ORGANISATOR UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Amanda, Putri (2023) HUBUNGAN ANTARA KEPRIBADIAN HARDINESS DENGAN KECEMASAN MENINGGALKAN KELUARGA PADA ANGGOTA TNI-AD BATALYON INFANTERI RAIDERS 400 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Amarulloh, Laqfan Falasifa (2020) HUBUNGAN ANTARA KONTROL DIRI DENGAN PERILAKU KONSUMTIF BELANJA ONLINE PADA DEWASA AWAL PETET TUNTANG KABUPATEN SEMARANG JAWA TENGAH. Undergraduate thesis, Universitas Islam Sultan Agung.

Amelia, Dinda Sekar (2022) HUBUNGAN ANTARA PENERIMAAN DIRI DENGAN PERBANDINGAN SOSIAL PADA REMAJA AKHIR PENGGUNA MEDIA SOSIAL INSTAGRAM. Undergraduate thesis, Universitas Islam Sultan Agung.

Amelia, Yuanita Rizki (2017) HUBUNGAN ANTARA PERSEPSI DUKUNGAN SOSIAL DENGAN KESEJAHTERAAN SUBYEKTIF PADA IBU BEKERJA PADA KANTOR UNIT PELAYANAN PENDAPATAN DAN PEMBERDAYAAN ASET DAERAH (UP3AD) SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Aminah, Aminah (2018) HUBUNGAN KONSEP DIRI DENGAN KESIAPAN BELAJAR MANDIRI MAHASISWA BARU UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Amrin, Megawati (2014) HUBUNGAN ANTARA KESESAKAN DAN STRES LINGKUNGAN DENGAN PERILAKU AGRESIF NARAPIDANA DI LEMBAGA PEMASYARAKATAN KLAS I KEDUNGPANE SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Amrullah, Muhammad Taufiq (2004) HUBUNGAN ANTARA ASERTIFITAS DENGAN PRESTASI BELAJAR PADA SISWA - SISWI MADRASAH ALIYAH NURUL ULUM MRANGGEN DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ananda, Lutfia Rizky (2019) HUBUNGAN ANTARA BERPIKIR POSITIF DAN EFIKASI DIRI DENGAN KECEMASAN BERBICARA DI DEPAN UMUM PADA MAHASISWA UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Andreyani, Nova Dwi (2021) HUBUNGAN ANTARA INTENSITAS BERMEDIA SOSIAL DENGAN PROKRASTINASI MENGERJAKAN SKRIPSI PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Andrian, Moh Farid Dwi (2023) HUBUNGAN ANTARA EFIKASI DIRI DENGAN PERILAKU HELP SEEKING TERKAIT PEMILIHAN JURUSAN KULIAH PADA SISWA KELAS XII IPS SMAN 1 JUWANA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Andriani, Ayu (2020) HUBUNGAN ANTARA STRES DENGAN AGRESI VERBAL IBU RUMAH TANGGA DI KABUPATEN PATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Andriani, Rizqi Dewi (2020) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN KECEMASAN MENGHADAPI DUNIA KERJA PADA SISWA SMK NU LASEM. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Andriani, Tia Rifa (2019) HUBUNGAN ANTARA KONSEP DIRI DAN PENYESUAIAN DIRI DENGAN RESILIENSI MAHASISWA DALAM MENGHADAPI DAMPAK BANJIR DAN ROB. Undergraduate thesis, Universitas Islam Sultan Agung.

Anggina, Semira Zikri (2020) PELATIHAN SELF TALK POSITIF UNTUK MENURUNKAN KECEMASAN BERBICARA DI DEPAN UMUM PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Anggraeni, Alvina (2023) HUBUNGAN ANTARA EKSTERNAL LOCUS OF CONTROL DENGAN PEMBELIAN IMPULSIF PADA MAHASISWA PENGGUNA SHOPEE PAYLATER. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Anggraeni, Dian Maeza (2015) THE EFFECTIVENESS OF USING CARTOON SERIES PICTURES TO IMPROVE STUDENTS’ WRITING NARRATIVE TEXT. Undergraduate thesis, Fakultas Bahasa UNISSULA.

Anggraeni, Galuh Sinta (2018) PELAKSANAAN KONVERSI DAN DAMPAK HUKUM BAGI NASABAH BANK UMUM KONVENSIONAL KE BANK UMUM SYARIAH (Studi Kasus Akuisisi PT. Bank Sahabat Purba Danarta (BSPD) oleh Bank Tabungan Pensiunan Nasional (BTPN). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Anggraeni, Rani Widya (2021) HUBUNGAN ANTARA MINDFULNESS DENGAN STRESS PADA MAHASISWA AKHIR FAKULTAS HUKUM UNIVERSITAS HALUOLEO KENDARI. Undergraduate thesis, Universitas Islam Sultan Agung.

Anggraeni, Yuniar (2022) HUBUNGAN ANTARA KONTROL DIRI DAN GAYA HIDUP HEDONIS DENGAN PERILAKU KONSUMTIF PENGGUNA E-MONEY PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung.

Anggraini, Devi Rifky (2012) PENGARUH TAYANGAN IKLAN PRODUK KECANTIKAN DAN PERAWATAN TUBUH TERHADAP BODY DISSATISFACTION PADA MAHASISWI FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Anjani, Putri (2019) HUBUNGAN ANTARA INTERNAL LOCUS OF CONTROL DENGAN PROKRASTINASI AKADEMIK PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Anjari, Ayu Tali (2016) DINAMIKA PSIKOLOGIS SUBJEK DENGAN KECENDERUNGAN PERILAKU MENIMBUN (HOARDING). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Annisa, Rifka Retno (2016) PERBEDAAN SELF-ESTEEM DAN SUBJECTIVE WELL-BEING PADA GURU YANG TELAH BERSERTIFIKASI DENGAN GURU YANG BELUM BERSERTIFIKASI PADA SMA NEGERI X DI KOTA BAUBAU. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Annisa Firdaus, Niken (2022) HUBUNGAN ANTARA NILAI INDIVIDU DENGAN ADAPTABILITAS KARIR PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Anshari, Azharuddin Yusri (2023) HUBUNGAN PERSEPSI MASKULINITAS DENGAN KONSEP DIRI REMAJA AKHIR LAKI-LAKI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Antokoratri, Ayi (2008) Perbedaan Religiusitas dan Sikap terhadap Budaya Akademik Islami (BUDAI) antara Mahasiswa UNISSULA yang sudah ikut dan belum ikut Pelatihan Budaya Akademik Islami (BUDAI). Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Anwar, Achmad Choerul (2020) HUBUNGAN ANTARA KONSEP DIRI DAN DUKUNGAN SOSIAL KELUARGA DENGAN PERILAKU BELAJAR SISWA-SISWI SMA ISLAM SULTAN AGUNG 1 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Aprilia, Risa (2021) HUBUNGAN ANTARA REGULASI DIRI DENGAN AGRESIVITAS VERBAL PADA SISWA – SISWI DI MAN 1 KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Apriliana, Rusma (2015) HUBUNGAN ANTARA KECEMASAN TERHADAP KARIR MASA DEPAN DAN KONSEP DIRI AKADEMIK DENGAN PROKRASTINASI SKRIPSI PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Apriliani, Siti Fatimah Zahra (2022) HUBUNGAN ANTARA CELEBRITY WORSHIP DENGAN PERILAKU KOMSUMTIF REMAJA YANG BERKAITAN DENGAN IDOLA. Undergraduate thesis, Universitas Islam Sultan Agung.

Aprillia, Dita (2018) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN DEPRESI PADA NARAPIDANA DI LEMBAGA PEMASYARAKATAN KLAS II A BOJONEGORO. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Aprillia, Nita Sofia (2016) HUBUNGAN ANTARA KEPUASAN KERJA DENGAN KINERJA KARYAWAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Aprilliya, Reckha Wulan (2023) HUBUNGAN ANTARA SELF-ESTEEM DENGAN PERILAKU KONSUMTIF PADA SISWA MA AL-HIDAYAT LASEM. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Apriyadi, Dodi (2020) HUBUNGAN ANTARA EFIKASI DIRI DENGAN BURNOUT PADA MAHASISWA UNIVERSITAS SEMARANG YANG BEKERJA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Apriyadi, Dodi (2019) HUBUNGAN ANTARA EFIKASI DIRI DENGAN BURNOUT PADA MAHASISWA UNIVERSITAS SEMARANG YANG BEKERJA. Undergraduate thesis, Universitas Islam Sultan Agung.

Apriyant, S.A.Krisa (2012) HUBUNGAN ANTARA PERSEPSI TERHADAP KOMPETISI DAN MASA KERJA DENGAN STRES KERJA PADA SALESMAN PT.H. M.PERSADA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Aprizal, Fatima Sari (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL KELUARGA DENGAN KESEPIAN PADA ANDIKPAS DI LEMBAGA PEMBINAAN KHUSUS ANAK (LPKA) KUTOARJO JAWA TENGAH. Undergraduate thesis, Universitas Islam Sultan Agung.

Ardelia, Farra Avisa (2021) HUBUNGAN ANTARA PERILAKU OVERPROTECTIVE ORANG TUA DENGAN PENYESUAIAN DIRI PADA REMAJA DI SMA WALISONGO PECANGAAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ardelia, Farra Avisa (2021) HUBUNGAN ANTARA PERILAKU OVERPROTECTIVE ORANG TUA DENGAN PENYESUAIAN DIRI PADA REMAJA DI SMA WALISONGO PECANGAAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ardhiyanti, Shinta Maylindha (2022) HUBUNGAN ANTARA BEBAN KERJA DAN LINGKUNGAN KERJA TERHADAP BURNOUT PADA KARYAWAN PT TRIANGLE MOTORINDO SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Ardi, Pingka Cylvia Mahardika (2022) GAMBARAN COPING STRESS PADA REMAJA YANG BERADAPTASI DENGAN KELUARGA BARU. Undergraduate thesis, Universitas Islam Sultan Agung.

Ardiani, Arifah (2017) TINJAUAN YURIDIS TERHADAP TINDAK PIDANA KEKERASAN FISIK DALAM LINGKUP RUMAH TANGGA (studi kasus putusan No.171 / Pid.Sus / 2015 / PN pengadilan Negeri Semarang). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ardiyanti, Ardiyanti (2016) EFEKTIVITAS AFIRMASI DIRI UNTUK MENURUNKAN STRES PADA NARAPIDANA DI BAWAH UMUR. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Arief, Ardhi (2017) HUBUNGAN ANTARA KECERDASAN EMOSI DENGAN KEMAMPUAN PENYELESAIAN MASALAH PADA AKTIVIS MAHASISWA UNISSULA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Arifin, Faisal (2022) HUBUNGAN ANTARA HARGA DIRI DENGAN PRESENTASI DIRI PADA MAHASISWA PENGGUNA INSTAGRAM DI KEBUMEN. Undergraduate thesis, Universitas Islam Sultan Agung.

Arini, Ghina (2016) HUBUNGAN ANTARA KEMATANGAN EMOSI DENGAN AGGRESSIVE DRIVING PADA REMAJA DI SMA PGRI 1 KUDUS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Aris, Asrina (2017) HUBUNGAN ANTARA PERSEPSI MAHASISWA TERHADAP DOSEN PEMBIMBING SKRIPSI DENGAN STRES DALAM MENULIS SKRIPSI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Aristanti, Renita (2019) HUBUNGAN ANTARA KONTROL DIRI (SELF CONTROL) DENGAN KECANDUAN INTERNET (INTERNET ADDICTION) PADA REMAJA PENGGEMAR (KOREAN POP) K-POP DI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Arlieza, Deassiana Nizfa (2014) PENGARUH PENYULUHAN TENTANG KESIAPAN MENGHADAPI MENARCHE TERHADAP KECEMASAN ANAK MENGENAI MENARCHE. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Arrosyidah, Shofuro (2022) HUBUNGAN ANTARA REGULASI DIRI DAN DUKUNGAN SOSIAL KELUARGA TERHADAP RESILIENSI PADA MAHASISWA FAKULTAS TEKNIK UNIVERSITAS X YANG MENGERJAKAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Arrum, Arrum (2020) KEPUASAN PERNIKAHAN PADA PASANGAN YANG BELUM DIKARUNIAI KETURUNAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Arum, Nugraini Arsiska (2021) HUBUNGAN ANTARA TIPE KEPRIBADIAN EKSTROVET DENGAN AGRESIFITAS PADA ANGGOTA BALAP MOTOR LIAR. Undergraduate thesis, Universitas Islam Sultan Agung.

Arumsari, Widya Putri (2022) HUBUNGAN ANTARA KESEHATAN MENTAL DENGAN MOTIVASI BELAJAR PADA SISWA SMA. Undergraduate thesis, Universitas Islam Sultan Agung.

Arzad, Ibun (2021) HUBUNGAN ANTARA KONTROL DIRI DENGAN PERILAKU KONSUMTIF BELANJA ONLINE PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Asmira, Wa Ode Nur (2017) HUBUNGAN ANTARA SCHOOL BONDING DENGAN PERILAKU MEROKOK PADA REMAJA DI SMP AL-FATTAH. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Asriningtyas, Ratna Pawestri (2016) KECEMASAN MEMBANGUN RELASI INTIM PADA WANITA PASCA MELAKUKAN HUBUNGAN SEKS DI LUAR NIKAH. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Assyifa, M. Dafa Aulia (2023) HUBUNGAN ANTARA KEPUASAN KERJA DENGAN KESEJAHTERAAN PSIKOLOGIS PADA KARYAWAN KONTRAK CV FIAN PUTRA BATANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Astari, Maya (2017) HUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN KONFORMITAS KELOMPOK PADA SISWA SMA X SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Astarina, Esti Tri (2020) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KECEMASAN DALAM MENGHADAPI UJIAN NASIONAL PADA KELAS XII DI SMA NEGERI 10 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Asti, Cyntia Rosemasita Mulyaning (2016) HUBUNGAN ANTARA KONSEP DIRI DAN PERSEPSI TERHADAP DUKUNGAN SOSIAL PENGHUNI PANTI DENGAN PENYESUAIAN DIRI PADA REMAJA DI BALAI REHABILITASI SOSIAL SUKO MULYO TEGAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Astika, Mirza Novandya (2016) HUBUNGAN EMOTION FOCUS COPINGDENGAN MOTIVASI BELAJAR PADA MAHASISWA PERANTAUAN FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Astuti, Dewi Riskaya (2019) HUBUNGAN ANTARA PERILAKU MENONTON TAYANGAN KEKERASAN DAN PERSEPSI TERHADAP POLA ASUH PERMISIF DENGAN AGRESIVITAS PADA SISWA SD DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Astuti, Maulydia Dwi (2021) HUBUNGAN ANTARA DUKUNGAN SOSIAL KELUARGA DENGAN MOTIVASI BELAJAR PADA SISWA SMP NEGERI 1 BANDAR LAMPUNG. Undergraduate thesis, Universitas Sultan Agung.

Astuti, Yuni (2004) PRODUKTIVITAS KARYAWAN DITINJAU DARI KEBUTUHAN AKTUALISASI DIRI DAN PERSEPSI TERIIADAP PEKERJAAN PADA PT. LARALADEN SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Aswati, Medina Hajar (2003) HUBUNGAN ANTARA MOTIVASI KERJA KARYAWAN DITINJAU DARI PERSEPSI TERHADAP GAJI, INSENTIF DAN LING KUN GAN KERJA DI PT. NYONYA MENEER SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Athahaura, Ghinasaffa Auliza (2022) HUBUNGAN ANTARA KOMPENSASI DAN DISIPLIN KERJA TERHADAP LOYALITAS KERJA PADA KARYAWAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Athiyah, Widad (2023) HUBUNGAN ANTARA KONSEP DIRI DAN ZUHUD TERHADAP MOTIVASI BERPRESTASI PADA SANTRI SMP IT PONDOK PESANTREN X. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Atmaja, Pradita Eka Kusuma (2017) TINJAUAN YURIDIS TENTANG PENYIDIKAN TINDAK PIDANA KEKERASAN FISIK TERHADAP PEREMPUAN DALAM RUMAH TANGGA DI POLRES DEMAK. Undergraduate thesis, Fakultas Hukum UNISSULA.

Atsniyah, Lia (2019) MAKNA HIDUP SANTRI PENGABDIAN PONDOK PESANTREN NURUL AMAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Aulia, Velina (2023) HUBUNGAN ANTARA KOHESIVITAS DENGAN KONFORMITAS PADA KOMUNITAS VESPA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Awaliyah, Elok (2018) HUBUNGAN ANTARA KONSEP DIRI DENGAN KECEMASAN DALAM MENGHADAPI DUNIA KERJA PADA MAHASISWA SEMESTER AKHIR DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Awaliyah, Elok (2018) HUBUNGAN ANTARA KONSEP DIRI DENGAN KECEMASAN DALAM MENGHADAPI DUNIA KERJA PADA MAHASISWA SEMESTER AKHIR DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Awallaila, Syamira Afrah (2020) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN KONSEP DIRI DENGAN PENYESUAIAN DIRI PADA SANTRIWATI BARU DI PONDOK PESANTREN ASKHABUL KAHFI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Awallaila, Syamira Afrah (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN KONSEP DIRI DENGAN PENYESUAIAN DIRI PADA SANTRIWATI BARU DI PONDOK PESANTREN ASKHABUL KAHFI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Ayni, Fitriyah Qurrotul (2017) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN PROBLEM FOCUSED COPING PADA ORANG TUA YANG MEMILIKI ANAK AUTIS DI SLB N SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ayu Setyaningrum, Diyah (2023) HUBUNGAN POLA ASUH OTORITER ORANG TUA TERHADAP KEMATANGAN EMOSI PADA REMAJA DI SMA NEGERI 3 PATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ayudya Paulina, Dinda (2023) HUBUNGAN ANTARA HARGA DIRI DENGAN PENGALAMAN KEKERASAN DALAM BERPACARAN PADA MAHASISWI UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ayukusuma, Putri Awaliana (2016) PERBEDAAN PERILAKU PRO LINGKUNGAN DILIHAT DARI ORIENTASI NILAI PERSONAL PADA MAHASISWA PECINTA ALAM. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ayuningsih, Desy (2017) RESILIENSI PADA REMAJA DENGAN KELUARGA BERCERAI DI KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ayuningtias, Furi (2022) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DENGAN PROKRASTINASI AKADEMIK PADA SISWA-SISWI SMAN 01 BODEH. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Azalea, Aurora Dhifal (2021) HUBUNGAN ANTARA HARGA DIRI DAN DUKUNGAN SOSIAL TERHADAP RESILIENSI PADA KELUARGA ODGJ DI KABUPATEN PEMALANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Azaria, Ummi Nabila (2017) ADVERSITY QUOTIENT PADA SISWA HOMESCHOOLING. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Azdim, Mohammad Nor (2021) HUBUNGAN ANTARA EFIKASI DIRI DENGAN TINGKAT KECEMASAN MAHASISWA YANG SEDANG MENGHADAPI SKRIPSI DI FAKULTAS PENDIDIKAN BAHASA DAN SENI UNIVERSITAS PGRI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Azimah, Ainiyatul (2020) HUBUNGAN ANTARA POLA ASUH DEMOKRATIS ORANG TUA DENGAN PERILAKU PROSOSIAL PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Azizah, Marwa (2023) HUBUNGAN ANTARA IMPRESSION MANAGEMENT DAN TRUST DENGAN NEGATIVE EMOTIONAL DISCLOSURE DI MEDIA SOSIAL PADA MAHASISWA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Azizi, Rohmat Taufiq (2019) HUBUNGAN ANTARA ASERTIVITAS DENGAN PERILAKU CYBERBULLYING DI JEJARING SOSIAL PADA SISWA SMA X DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

Azmi, Ilham Nabil (2021) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KECEMASAN MENGHADAPI DUNIA KERJA PADA SISWA SMK CUT NYAK DIEN SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Azmiani, Azmiani (2016) HUBUNGAN SIKAP LAKI-LAKI TERHADAP KESETARAAN GENDER DENGAN KEKERASAN DALAM PACARAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Azzaky, Wahyu (2010) HUBUNGAN ANTARA PERSEPSI TERHADAP BUDAYA ORGANISASI MENWA DENGAN KECENDERUNGAN PERILAKU AGRESI DAN KECENDERUNGAN PERILAKU ASSERTIF PADA ANGGOT A MENW A DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Azzala, Quineke Laksmi (2022) PERAN ANTARA POLA ASUH OTORITATIF DAN EFIKASI DIRI DENGAN PRESTASI BELAJAR MATEMATIKA SISWA SMP X KOTA TEGAL DI ERA PANDEMI COVID-19. Undergraduate thesis, Universitas Islam Sultan Agung.

A’isyah, Siti (2017) HUBUNGAN ANTARA PENERIMAAN DIRI DENGAN RESILIENSI PADA REMAJA PANTI ASUHAN DI KABUPATEN PATI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

A’yun, Silvia Qurota (2023) HUBUNGAN ANTARA GAYA HIDUP HEDONIS DENGAN PERILAKU KONSUMTIF PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

A’yunina, Hilma (2019) HUBUNGAN ANTARA STRES AKADEMIK DAN MOTIVASI BERPRESTASI DENGAN PROKRASTINASI AKADEMIK PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

B

BAKHTIAR, WASUKO GAYUH (2022) HUBUNGAN ANTARA STRES KERJA TERHADAP BEBAN KERJA KARYAWAN BPJS KETENAGAKERJAAN SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

BALI, IKA ASTER LESTARI (2005) HUBUNGAN ANT ARA EFIKASI DIRI TERHADAP PELAJARAN MATEMATIKA DENGAN PRESTASI BELAJAR MATEMATIKA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Badawi, Nia Nabila (2016) PENERIMAAN DIRI PADA WANITA DEWASA MADYA TIDAK MENIKAH. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Badiiah, Roudhotul (2014) DAMPAK PSIKOLOGIS KEKERASANPADA ANAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Bahari Yanti, Nita (2004) HUBUNGAN ANTARA SIKAP PENERIMAAN KARYAWAN INDUSTRI ATAS PERUBAHAN STATUS KEPEMILIKAN PERUSAHAAN DARI MOSQUITO COIL GROUP KE PT. RECKITT BENCKISER INDONESIA DENGAN PRODUKTIVITAS KERJA KARYAWAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Bahari Yanti, Nita (2003) KARAKTERISTIK PERILAKU KARYAWAN INDUSTRI DALAM PERUBAHAN STATUS KEPEMILIKAN DARI KEPEMILIKAN MOSQUITO COIL GROUP KE PT. RECKJTT BENCKISER INDONESIA (STUDI KASUS PT. SINAR PLATACO DAN PT. MENARA KALOKA). Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Baharuddin, Al Imron Tri Yudha Sakti (2017) HUBUNGAN ANTARA KONSEP DIRI DAN KONFORMITAS DENGAN PERILAKU KONSUMTIF PADA SISWA SMA SULTAN AGUNG 1 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Baharuddin, Ode Firmansyah (2016) HUBUNGAN ANTARA SELF-EFFICACY DAN HARGA DIRI DENGAN PERILAKU MENYONTEK PADA SISWA SMP 4 SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Baiti, Laily Nur (2021) HUBUNGAN ANTARA INTENSITAS MENONTON DRAMA KOREA DENGAN SUASANA HATI MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Baitina, Annisa (2015) KECEMASAN ISTRI TNI YANG DITINGGAL BERTUGAS KE LUAR DAERAH DITINJAU DARI TINGKAT RELIGIUSITAS DAN FREKUENSI KOMUNIKASI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Balitar, Surya (2014) DAMPAK PSIKOLOGIS KORBAN PEMERKOSAAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Bandhayuda, Kemal Pandu Jaring (2017) HUBUNGAN ANTARA KONTROL DIRI DENGAN KENAKALAN REMAJA DI DESA PURWOKERTO KABUPATEN KENDAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Basma, Rojwa Aqilla (2022) PERSEPSI TERHADAP CITRA TUBUH DAN KECEMASAN SOSIAL PADA REMAJA PEREMPUAN PENGGUNA MEDIA SOSIAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Bayuh Saputra, Dimas (2023) HUBUNGAN ANTARA ANONIMITAS DENGAN KETERBUKAAN DIRI PENGGUNA MEDIA SOSIAL PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Bestari, Wachyuning (2014) HUBUNGAN ANTARA MINAT MENJADI GURU DENGAN KOMITMEN KERJA GURU HONORER SD DI UPPD KECAMATAN TEGAL SELATAN KOTA TEGAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Bila, Malda Nur Salsa (2021) HUBUNGAN KONFORMITAS TEMAN SEBAYA DAN KONTROL DIRI DENGAN KEPATUHAN TERHADAP PERATURAN SEKOLAH PADA SISWA SMP NEGERI 1 ADIWERNA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Bilal, Ahmad (2019) HUBUNGAN ANTARA PERSEPSI TERHADAP GAYA KEPEMIMPINAN DENGAN STRES KERJA PADA SATPAM DI UNIVERSITAS X. Undergraduate thesis, Universitas Islam Sultan Agung.

Bima, Farkhansyah Harya (2021) PENGARUH MOTIVASI BELAJAR DAN OPTIMISME TERHADAP INDEKS PRESTASI KUMULATIF MAHASISWA ANGKATAN 2017 UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Bintang, Arya (2016) HUBUNGAN ANTARA KESEPIAN DENGAN KECANDUAN GAME ONLINE PADA PEREMPUAN DEWASA MUDA DI KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Budiarti, Ramadhani Wulan (2021) HUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEBAYA DAN KECERDASAN EMOSIONAL DENGAN PENYESUAIAN DIRI MAHASISWA TAHUN PERTAMA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Budiarto, Agung (2021) HUBUNGAN ANTARA LOCUS OF CONTROL DENGAN MINAT BERWIRAUSAHA PADA SISWA SMK X PETARUKAN KABUPATEN PEMALANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Budiarto, Dodi Adi (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN RESILIENSI DENGAN MOTIVASI BERPRESTASI PADA REMAJA YANG MEMILIKI ORANGTUA TUNGGAL. Undergraduate thesis, Universitas Islam Sultan Agung.

C

CIPTO, CIPTO (2011) HUBUNGAN ANTARA HARGA DIRI DAN KONFORMITAS TERHADAP KELOMPOK DENGAN PERILAKU MINUM MINUMAN BERALKOHOL PADA REMAJA YANG MENONTON KONSER MUSIK ROCK DI KOTA KUDUS. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Caertine Azura Muninggar, Anisya (2023) KETERBUKAAN DIRI PADA PENGGUNA APLIKASI KENCAN DARING DITINJAU DARI HARGA DIRI DAN KEPERCAYAAN (TRUST). Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Cahyani, Anggun Dwi (2018) PERAN DUKUNGAN SOSIAL DALAM KELOMPOK SEBAYA DAN KEPATUHAN TERAPI ARV TERHADAP KUALITAS HIDUP PADA ORANG DENGAN HIV& AIDS DI YAYASAN VICTORY PLUS YOGYAKARTA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Cahyani, Musti (2014) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU AGRESIF REMAJA DI SMP “X”. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Cahyaningrum, Rakhma Nur (2021) HUBUNGAN ANTARA KETIDAKPUASAN TUBUH TERHADAP PERILAKU DIET PADA REMAJA PEREMPUAN DI SMA ISLAM SULTAN AGUNG 1 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Cahyanti, Siti Maya (2022) HUBUNGAN ANTARA HARGA DIRI DAN DEPRESI DENGAN PEMBELIAN KOMPULSIF PADA PENGGEMAR KPOP. Undergraduate thesis, Universitas Islam Sultan Agung.

Candra, Siswaning Nuki Adi (2022) HUBUNGAN ANTARA KEPERCAYAAN DIRI DAN KECEMASAN BERBICARA DI DEPAN UMUM MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Chaerani, Annisa Prisma (2020) HUBUNGAN ANTARA PERSEPSI TERHADAP LINGKUNGAN BELAJAR DENGAN MOTIVASI BELAJAR PADA WARGA BELAJAR PAKET C DI SANGGAR KEGIATAN BELAJAR KABUPATEN BLORA JAWA TENGAH. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Chairunnisa, Febialma Salsabila (2021) HUBUNGAN ANTARA DUKUNGAN SOSIAL ORANG TUA DENGAN OPTIMISME MENGHADAPI DUNIA KERJA PADA MAHASISWA TINGKAT AKHIR DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Chakimah, Amalia (2017) HUBUNGAN ANTARA KEPUASAN KERJA DAN KOMPENSASI DENGAN KEINGINAN BERPINDAH PADA PEGAWAI KOSPIN JASA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Chamim, Agus (2016) HUBUNGAN ANTARA KONSEP DIRI DENGAN KECEMASAN TERHADAP LINGKUNGAN PADA MAHASISWA YANG BERTEMPAT TINGGAL DI DAERAH RAWAN PENCURIAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Chasanah, Endang Muslihatun (2017) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN ASERTIVITAS DALAM MENYAMPAIKAN PENDAPAT PADA AKTIVIS MAHASISWA/I DI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

D

DEWI ANGELIA, CITRA (2023) HUBUNGAN ANTARA KONFORMITASTERHADAP PERILAKU KONSUMTIF PADA PENGGEMAR K-POP BTS (ARMY). Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

DIAN I. P., SEPTRI (2012) RESILIENSI PADA PEREMPUAN KORBAN KEKERASAN DALAM RUMAH TANGGA (KDRT) DI LEGAL RESOURCES CENTER– KEADILAN JENDER DAN HAM (LRC-KJHAM). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Daima, Izza Harera (2017) HUBUNGAN ANTARA OPTIMISME DAN DUKUNGAN SOSIAL TERHADAP KESEJAHTERAAN SUBJEKTIF PADA REMAJA YATIM PIATU DI PANTI ASUHAN X SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Dale, Asti Asmerianingsih (2016) HUBUNGAN ANTARA EFIKASI DIRI DAN DUKUNGAN SOSIAL DENGAN BURNOUT PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Damayanti, Dyah Dwi (2016) URGENSI PENTINGNYA PROSEDUR DAN PENGELOLAAN PENGELUARAN KAS PADA PT. SINAR SOSRO KPW – JATENG. Diploma thesis, Fakultas Psikologi UNISSULA.

Damayanti, Febi (2023) PENGARUH POLA ASUH PERMISIF DAN KONTROL DIRI TERHADAP KECENDERUNGAN ADIKSI GAME ONLINE PADA REMAJA DI SMA X BATAM. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Defitria, Vani (2017) HUBUNGAN ANTARA KONSEP DIRI DENGAN PENYESUAIAN DIRI PADA SANTRIWATI BARU DI PONDOK PESANTREN FUTUHIYYAH MRANGGEN DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Deliana, Dati (2019) HUBUNGAN ANTARA REGULASI DIRI DAN DUKUNGAN SOSIAL KELUARGA DENGAN KECEMASAN MENGHADAPI UJIAN NASIONAL PADA SISWA KELAS IX DI SMP N 9 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Deliana, Dati (2020) HUBUNGAN ANTARA REGULASI DIRI DAN DUKUNGAN SOSIAL KELUARGA DENGAN KECEMASAN MENGHADAPI UJIAN NASIONAL PADA SISWA KELAS IX DI SMP N 9 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Delinda, Istaanda Florien (2022) HUBUNGAN ANTARA KEPERCAYAAN DIRI DAN MOTIVASI BERPRESTASI DENGAN KEMALASAN SOSIAL DALAM MENYELESAIKAN TUGAS KELOMPOK PADA MAHASISWA FAKULTAS TEKNOLOGI INDUSTRI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Densi, Surya (2022) HUBUNGAN PUSAT KENDALI DIRI INTERNAL (INTERNAL LOCUS OF CONTROL) DENGAN KEPEMIMPINAN YANG MELAYANI (SERVANT LEADERSHIP) PADA KETUA ORGANISASI MAHASISWA UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Devy, Olivia Cornelia (2017) HUBUNGAN RASA SYUKUR DAN HARGA DIRI TERHADAP KESEJAHTERAAN PADA REMAJA PEREMPUAN KORBAN KEKERASAN DALAM PACARAN. Masters thesis, Fakultas Psikologi UNISSULA.

Dewantara, Mohammad Wimarangga (2022) HUBUNGAN ANTARA TOXIC PARENTS TERHADAP PRILAKU PERUNDUNGAN SIBER (CYBERBULLYING) PADA REMAJA DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Dewi, Annisa Chandra (2022) HUBUNGAN ANTARA PERSEPSI TERHADAP CITRA TUBUH DENGAN HARGA DIRI PADA MAHASISWI DI UNIVERSITAS X KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Dewi, Desi Ambarita (2016) KONFLIK RELIGIUS PADA LAKI-LAKI HOMOSEKSUAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Dewi, Dian Pasuka (2022) HUBUNGAN ANTARA KONTROL DIRI DENGAN KECANDUAN SMARTPHONE PADA SISWA SMA X DI PURWODADI. Undergraduate thesis, Universitas Islam Sultan Agung.

Dewi, Eneng Heni Puspita (2016) Mekanisme Pemberian Dan Pengelolaan Kredit Kepada Nasabah PadaPT. BPR Kusuma Sumbing Kantor Cabang Sukorejo Kendal. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Dewi, Maharani Cahya (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN PENYESUAIAN DIRI DENGAN KECEMASAN MENGHADAPI MASA PENSIUN PADA PRAJURIT TNI KODIM 0716/DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

Dewi, Maharani Cahya (2020) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN PENYESUAIAN DIRI DENGAN KECEMASAN MENGHADAPI MASA PENSIUN PADA PRAJURIT TNI KODIM 0716/DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Dewi, Mega Anggi Citra (2018) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN KEMANDIRIAN BELAJAR PADA SISWA KELAS X SMA ‘X’ DI KABUPATEN BANJARNEGARA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Dewi, Puspita Nor Auliya (2019) HUBUNGAN ANTARA POLA ASUH PERMISIF DENGAN MOTIVASI BELAJAR PADA SISWA KELAS XI SMA N 1 JEPARA. Undergraduate thesis, Universitas Islam Sultan Agung.

Dewi, Saka (2018) HUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEBAYA DAN KEPERCAYAAN DIRI AKADEMIK DENGAN REGULASI DIRI DALAM BELAJAR PADA MAHASISWA DI UNIVERSITAS X. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Dewi A, Kartika (2015) KONSEP DIRI DAN PENERIMAAN DIRI WARIA (TRANSGENDER). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Dian Alisa Putri, Mellinda (2023) HUBUNGAN ANTARA POLA ASUH PERMISIF DENGAN KECANDUAN GADGET PADA SISWA SMP NEGERI 34 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Diani, Azona Paramitha (2020) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU SEKSUAL PRANIKAH PADA REMAJA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Dianita, Harya (2019) PERAN TAWAKAL DAN DUKUNGAN SOSIAL KELUARGA TERHADAP RESILIENSI PADA PASIEN GAGAL GINJAL YANG MENJALANI TERAPI HEMODIALISIS. Undergraduate thesis, Universitas Islam Sultan Agung.

Diansyah, Arfah (2016) HUBUNGAN ANTARA SELF-EFFICACYDAN PENYESUAIAN DIRIDENGAN PRESTASI AKADEMIK PADA MAHASISWA PENERIMA BEASISWA X DI UNIVERSITAS X SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Diba, Fuzna Ghina Farrah (2019) PERAN KECERDASAN EMOSI DAN KONTROL DIRI TERHADAP RESOLUSI KONFLIK PADA ISTRI TENTARA. Undergraduate thesis, Universitas Islam Sultan Agung.

Dinata, Bayu Putra (2023) PERSEPSI TERHADAP PERAN PENYEMBUH TRADISIONAL DALAM MENANGANI GANGGUAN JIWA: STUDY KASUS DESA SESAIT. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Diwa Kusuma Yudha, Aditya (2022) HUBUNGAN ANTARA KEBERSYUKURAN DENGAN CITRA TUBUH PADA SISWA SMA NEGERI 1 JAKENAN, PATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Dwi R, Caprryana (2020) HUBUNGAN ANTARA REGULASI DIRI DENGAN PERILAKU PROKRASTINASI AKADEMIK PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Dwi R., Caprryana (2019) HUBUNGAN ANTARA REGULASI DIRI DENGAN PERILAKU PROKRASTINASI AKADEMIK PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Dwiaprilianti, Farah Ayu (2023) HUBUNGAN ANTARA KEPERCAYAAN DENGAN SELF DISCLOSURE PADA PENGGUNA TIKTOK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

E

Efantiana, Lilik Nila (2017) HUBUNGAN ANTARA RASA SYUKUR DAN HARGA DIRI DENGAN SUBJECTIVE WELL-BEING PADA REMAJA PANTI ASUHAN “X” KOTA JEPARA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Efrianti, Efrianti (2016) HUBUNGAN ANTARA RASA SYUKUR DAN KESEJAHTERAAN SUBJEKTIFPADA KARYAWAN KONTRAK DI PT. YANG MING INTERNASIONAL SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Enggelina, Sela (2022) HUBUNGAN ANTARA PENGGUNAAN MEDIA SOSIAL DENGAN INSOMNIA PADA MAHASISWA TINGKAT AKHIR FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ervianto, Ervianto (2016) HUBUNGAN ANTARA RELIGIUSITAS DENGAN RESILIENSI PADA MAHASISWA SULAWESI TENGGARA DI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Esthinobo, Duwung (2020) HUBUNGAN ANTARA MURAQABAH DAN KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU MENYONTEK PADA SISWA SMK MUHAMMADIYAH KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

F

FAJARWATI, ANNISA NUR (2008) PENGARUH PELATIHAN ESQ TERHADAP TINGKAT RELIGIUSITAS PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

FATIH, NAUFAL HAIDAR (2023) KONTROL DIRI PADA AKTIVIS MAHASISWA (Fenomenologi Pada Aksi Demonstrasi). Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fadhanah, Harjanti Resti (2023) HUBUNGAN ANTARA PROBLEM FOCUSED COPING DAN KESEJAHTERAAN PSIKOLOGIS REMAJA YANG ORANG TUA BERCERAI. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Fadhila, Agnesia (2021) HUBUNGAN KOPING STRES DENGAN RESILIENSI PADA TARUNA TINGKAT I DI POLITEKNIK ILMU PELAYARAN SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fadhila, Arifa Farras (2023) HUBUNGAN ANTARA MINDFUL PARENTING DENGAN KECEMASAN MASA DEPAN ANAK PADA ORANG TUA ANAK BERKEBUTUHAN KHUSUS DI SLB YPLB DANYANG KECAMATAN PURWODADI KABUPATEN GROBOGAN. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Fadhila, Rizki (2023) HUBUNGAN ANTARA KONFLIK PERAN GANDA DENGAN STRES KERJA PADA KARYAWAN WANITA PT SAMWON BUSANA INDONESIA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fadhilah, Laila Nur (2016) ADVERSITY QUOTIENT PADA DIFABEL FISIK YANG BEKERJA DI KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Fadhilah, Nilta (2015) DAMPAK PSIKOLOGIS HUMAN TRAFFICKING. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Fadila, Monita Elivian (2023) HUBUNGAN ANTARA MOTIVASI BELAJAR DENGAN PROKRASTINASI AKADEMIK PADA MAHASISWA PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Fadilah, Rizqi (2017) HUBUNGAN ANTARA EFIKASI DIRI DENGAN ORIENTASI MASA DEPAN PADA SISWA SMA KELAS XII DI SMA N 1 COMAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Fadillah, Hana Nurlaeli (2019) HUBUNGAN ANTARA INTERNAL LOCUS OF CONTROL DENGAN STRES PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA YANG SEDANG MENGERJAKAN SKRIPSI. Undergraduate thesis, Universitas Islam Sultan Agung.

Fahmi, Ahmad Rizal (2023) HUBUNGAN ANTARA EFIKASI DIRI DAN KEMATANGAN KARIR PADA MAHASISWA TINGKAT AKHIR FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fahrani, Titis Tri (2023) HUBUNGAN SOCIAL COMPARISON DENGAN KETIDAKPUASAN BENTUK TUBUH PADA MAHASISWI FAKULTAS EKONOMI UNIVERSITAS SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fairuz, Noor Elok (2017) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN KESEPIAN PADA TAHANAN DI POLDA JAWA TENGAH. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Faiz Hassan, Muhammad (2022) HUBUNGAN KONTROL DIRI DENGAN AGRESIVITAS SISWA YANG BERMAIN GAME ONLINE DI MTS NU DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fajar, Rizqa Nur (2017) HUBUNGAN ANTARA RELASI INTERPERSONAL GURU – SISWA DAN KUALITAS PERSAHABATAN DENGAN KESEJAHTERAAN PSIKOLOGIS DI SEKOLAH PADA SISWA SMP. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Fajriani, Ienats Tsuroya (2015) HUBUNGAN ANTARA HARGA DIRI DAN KEPUASAN KERJA DENGAN KESEJAHTERAAN SUBJEKTIF GURU MADRASAH TSANAWIYAH KECAMATAN WEDUNG DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Fajrin, Nurcholifah (2017) HUBUNGAN ANTARA KOHESIVITAS KELOMPOK DAN EFIKASI DIRI DENGAN KEMALASAN SOSIAL PADA ANGGOTA ORGANISASI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Fakhria, Milcha (2017) HUBUNGAN ANTARA FASILITASI SOSIAL DAN KETAKUTAN AKAN KEGAGALANDENGAN MOTIVASI BERPRESTASI PADA SISWA SEKOLAH MENENGAH ATAS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Falasifah, Malisa (2021) HUBUNGAN ANTARA LITERASI KESEHATAN MENTAL DAN STIGMA PUBLIK DENGAN SIKAP TERHADAP PENCARIAN BANTUAN PROFESIONAL PSIKOLOGIS PADA MAHASANTRI PESANMASA UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Farhana, Sherin (2023) HUBUNGAN ANTARA KESEJAHTERAAN PSIKOLOGIS DENGAN MENGIDOLAKAN SELEBRITI PADA PENGGEMAR NEO CULTURE TECHNOLOGY (NCT) KOTA SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Faridah, Nida (2021) HUBUNGAN REGULASI DIRI DENGAN FEAR OF MISSING OUT PENGGUNA INSTAGRAM PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Faris Hamzah, Faruq (2022) HUBUNGAN ANTARA KEBUTUHAN AFILIASI DENGAN KOMITMEN ORGANISASI PADA MAHASISWA AKTIVIS DI UNIVERSITAS ISLAM SULTAN AGUNG KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Farkhah, Miratul (2017) HUBUNGAN ANTARA KONTROL DIRI DENGAN MOTIVASI MEMBACA AL QUR’AN PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

FatchurRohman, FatchurRohman (2019) HUBUNGAN ANTARA PERILAKU MENGGUNAKAN MEDIA SOSIAL DENGANINTERAKSI SOSIAL PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Fathayah, Nur (2021) HUBUNGAN KEPERCAYAAN DIRI, KONFORMITAS, DAN PENGAMBILAN MATA KULIAH PILIHAN MAHASISWA PSIKOLOGI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fatmah, Amalia Fadila (2019) HUBUNGAN ANTARA RASA MEMILIKI DENGAN KOMITMEN ORGANISASI PADA PENGURUS ORGANISASI KEMAHASISWAAN DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Fatmah, Amalia Fadila (2020) HUBUNGAN ANTARA RASA MEMILIKI DENGAN KOMITMEN ORGANISASI PADA PENGURUS ORGANISASI KEMAHASISWAAN DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fatqiyah, Anita Fia (2023) HUBUNGAN POLA ASUH DEMOKRATIS DENGAN PERILAKU ASERTIF PADA SISWA KELAS XI SMK KY AGENG GIRI DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fatriana, Hanifa Isnaeni (2023) HUBUNGAN LOCUS OF CONTROL INTERNAL DAN KONSEP DIRI TERHADAP KELELAHAN AKADEMIK PADA MAHASISWA FAKULTAS EKONOMI YANG BEKERJA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Faukhana, Lina (2022) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KESIAPAN KERJA PADA MAHASISWA UPGRIS FAKULTAS TEKNIK DAN INFORMATIKA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fauzan, Ananda Afif Nur Adnan (2022) HUBUNGAN ANTARA FEAR of MISSING OUT (FOMO) DENGAN KECENDERUNGAN NOMOPHOBIA DI SMA NEGERI 1 PURWODADI. Undergraduate thesis, Universitas Islam Sultan Agung.

Fauzi, Abdul Wahid (2017) TINJAUAN YURIDIS TERHADAP PENYIDIKAN TINDAK PIDANA NARKOTIKA DI POLRESTABES SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Fauzi, Ahmad (2022) HUBUNGAN KETERBUKAAN DIRI DI MEDIA SOSIAL DENGAN INTERAKSI SOSIAL PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung.

Fauzia, Maya Arrizqina (2021) HUBUNGAN ANTARA REGULASI EMOSI DENGAN KESEJAHTERAAN PSIKOLOGIS PADA IBU DENGAN ANAK SCHOOL FROM HOME (SFH) PADA MASA PANDEMI COVID-19 DI DESA X. Undergraduate thesis, Universitas Islam Sultan Agung.

Fauziah, Fina (2023) HUBUNGAN ANTARA PERSEPSI TERHADAP KEMATIAN DENGAN BURNOUT PADA PERAWAT PASIEN COVID-19 DI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fauziah, Intan (2022) HUBUNGAN KEMATANGAN EMOSI DENGAN KEMAMPUAN BERSOSIALISASI SISWA KELAS VIII SMP N 1 KEDUNG JEPARA. Undergraduate thesis, Universitas Islam Sultan Agung.

Fauziah, Latifah (2022) HUBUNGAN ANTARA PENERIMAAN DIRI DENGAN RESILIENSI PADA IBU YANG MEMILIKI ANAK BERKEBUTUHAN KHUSUS DI SLB NEGERI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Fauziah, Luluk (2021) HUBUNGAN ANTARA INTENSITAS MELIHAT TIKTOK DENGAN PERILAKU KONSUMTIF PADA MAHASISWA. Undergraduate thesis, Universitas Sultan Agung.

Faza, Firnada Azmina (2023) HUBUNGAN ANTARA TIPE KEPRIBADIAN EKSTROVERT DAN JENIS KELAMIN DENGAN SELF DISCLOSURE PADA REMAJA PENGGUNA INSTAGRAM. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Faza, Jauhar (2023) HUBUNGAN ANTARA BUDAYA ORGANISASI DAN MOTIVASI BERORGANISASI DENGAN KOMITMEN BERORGANISASI PADA ANGGOTA BEM UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Faza, Uyun Nur (2022) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN PROBLEM FOCUSED COPING DENGAN PENYESUAIAN DIRI PADA SANTRI TAHFIDZUL QUR’AN PONDOK PESANTREN AL MUBAROK MRANGGEN DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

Fazirah, Mutiara (2020) HUBUNGAN ANTARA KONSEP DIRI DENGAN KECEMASAN MAHASISWA MENGHADAPI DUNIA KERJA PADA MASA PANDEMI COVID-19. Undergraduate thesis, Universitas Islam Sultan Agung.

Febri Mustika, Riski (2022) HUBUNGAN ANTARA CITRA MEREK DENGAN PERILAKU KONSUMTIF PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Febriana, Yane (2016) PENGARUH PEMBERIAN HUMOR TERHADAP KECEMASAN PASIEN PRA-OPERASI KANKER PAYUDARA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Febriana Areza Putri, Eka (2022) PERILAKU PROSOSIAL DAN KEBERMAKNAAN HIDUP PADA KOMUNITAS BERBAGI NASI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Febrilya, Anindita Ayu (2020) HUBUNGAN ANTARA EFIKASI DIRI DAN DUKUNGAN SOSIAL DENGAN KELELAHAN PADA PERAWAT JIWA DI RUMAH SAKIT JIWA DAERAH (RSJD) DR. AMINO GONDOHUTOMO PROVINSI JAWA TENGAH. Undergraduate thesis, Universitas Islam Sultan Agung.

Febriyanto, Muhammad Ilcharama (2016) HUBUNGAN ANTARA EXTRINSIC RELIGIOUS ORIENTATION DENGAN TRAIT GRATITUDEPADA MAHASISWA UNIVERSITAS XSEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Fiddini, Ulinuha Tsabita (2021) PHUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEBAYA DAN REGULASI DIRI DENGAN PROKRASTINASI AKADEMIK PADA MAHASISWA FAKULTAS EKONOMIKA DAN BISNIS UNIVERSITAS X. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Findiana, Aftina (2017) HUBUNGAN ANTARA GAYA HIDUP HEDONIS DENGAN PERILAKU KONSUMTIF DALAM MEMBELI IPHONE PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Fiqih, Fikri Tahta Nurul (2019) DUKUNGAN SOSIAL DAN OPTIMISME SEBAGAI PREDIKTOR STRESS-RELATED GROWTH PADA SANTRI DI PONDOK PESANTREN ASKHABUL KAHFI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Fiqria, Pamila Miftaqul (2021) HUBUNGAN ANTARA REGULASI EMOSI DENGAN KECENDERUNGAN SELF-INJURY PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Firdaus, Anisa (2021) HUBUNGAN ANTARA KETANGKASAN BELAJAR (LEARNING AGILITY) DENGAN EKSPLORASI KARIR PADA KARYAWAN MILENIAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Firdaus, Marta Dian (2016) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN PENERIMAAN ORANGTUA YANG MEMILIKI ANAK DISABILITAS INTELEKTUAL DI SLB WIDYA BHAKTI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Firdaus, Wahyuningtyas (2019) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KESULITAN PENGAMBILAN KEPUTUSAN KARIR PADA SISWA SMA NEGERI DAN SWASTA. Undergraduate thesis, Universitas Islam Sultan Agung.

Firdausa, Ayu (2021) HUBUNGAN ANTARA HARGA DIRI DAN KECERDASAN EMOSI DENGAN AGRESIVITAS PADA SISWA SMK N 10 SEMARANG. Undergraduate thesis, Universitas Sultan Agung.

Firdausa, Zarda Alifia (2019) HUBUNGAN ANTARA KESEPIAN DENGAN INTERAKSI PARASOSIAL PADA PEREMPUAN DEWASA MUDA ANGGOTA FANSCLUB PRILLVERS SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Fitri, Handayani (2022) KECERDASAN EMOSI DAN STRES KERJA PADA KARYAWAN PT TRIJAYA TISSUE PATI. Undergraduate thesis, Universitas Islam Sultan Agung.

Fitri, Nely Nafisatul (2019) HUBUNGAN ANTARA EFIKASI DIRI DENGAN PENYESUAIAN DIRI SANTRI BARU DI PONDOK PESANTREN TAHFIDZUL QUR’AN DI KECAMATAN SIRAMPOG KAB. BUMIAYU. Undergraduate thesis, Universitas Islam Sultan Agung.

Fitri, Rizky Souma (2019) HUBUNGAN ANTARA HARGA DIRI DAN ASERTIVITAS DENGAN PENGALAMAN KEKERASAN DALAM PACARAN PADA REMAJA PUTRI. Undergraduate thesis, Universitas Islam Sultan Agung.

Fitria, Lola Isna (2019) HUBUNGAN ANTARA KOPING RELIGIUS DENGAN KESEJAHTERAAN SUBJEKTIF PADA PENDERITA GAGAL GINJAL YANG MELAKUKAN CUCI DARAH (HEMODIALISA). Undergraduate thesis, Universitas Islam Sultan Agung.

Fitriani, Dita Anisa (2019) HUBUNGAN ANTARA KEMATANGAN EMOSI DAN RELIGIUSITAS DENGAN KESIAPAN MENIKAH PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Fitriani, Kurnia (2014) PERILAKU KOPING REMAJA TUNANETRA SISWA SLB NEGERI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Flaurend, Cindy Jihan (2023) HUBUNGAN EFIKASI DIRI (SELF EFFICACY) DENGAN KEBAHAGIAAN PADA REMAJA LKSA PANTI ASUHAN PUTRI AL-KHIDMAH MUKTIHARJO PATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Florantisya, Novira Ginsar (2015) PENERIMAAN ORANGTUA TERHADAP ANAK TUNARUNGU. Undergraduate thesis, Fakultas Psikologi UNISSULA.

faizah, Siti nur (2021) PENGARUH BURNOUT TERHADAP PROKRASTINASI AKADEMIK PADA ANAK DIDIK PANTI ASUHAN SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

fitriani, anita (2018) Hubungan Antara Komunikasi Interpersonal dengan Keadilan Prosedural terkait Penataan di Kampung Tambak Lorok Semarang. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

G

Gafur, Retno (2017) HUBUNGAN ANTARA MOTIVASI BELAJAR DAN EFIKASI DIRI DENGAN PRESTASI AKADEMIK MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG ANGKATAN 2014. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Garwati, Bidara Fi (2016) HUBUNGAN ANTARA KECERDASAN EMOSI DAN DUKUNGAN SOSIAL DENGAN KESEJAHTERAAN SUBJEKTIF PADA MAHASISWA TINGKAT I DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ghofiniyah, Elly (2016) HUBUNGAN ANTARA KEMATANGAN EMOSI DAN KETERAMPILAN SOSIAL DENGAN PENYESUAIAN DIRI PADA SANTRI PONDOK PESANTREN DAAR AL FURQON KUDUS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Girindra Syahdi, Muhammad (2023) HUBUNGAN ANTARA MOTIVASI KERJA DAN DISIPLIN KERJA DENGAN PRESTASI KERJA KARYAWAN PADA CABANG PRODUKSI HOME INDUSTRY BATIK AAN PEKALONGAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Gumelar, Sandy Agum (2021) HUBUNGAN ANTARA PERSEPSI GAYA KEPEMIMPINAN TRANSFORMASIONAL DAN KEPUASAN KERJA DENGAN LOYALITAS KERJA KARYAWAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Gunawan, Arief Rizal (2017) KESEJAHTERAAN PSIKOLOGIS NARAPIDANA SEUMUR HIDUP LAPAS KLAS I KEDUNGPANE SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Gusti, Denada Melinianda Aulia (2022) POST-TRAUMATIC GROWTH PASCA MASTEKTOMI PADA PENDERITA KANKER PAYUDARA YANG BELUM MENIKAH. Undergraduate thesis, Universitas Islam Sultan Agung.

Guswanto, Imam (2017) HUBUNGAN RASA MEMILIKI DAN KOMITMEN DENGAN MOTIVASI BERPRESTASI PEMAIN FUTSAL FAKULTAS DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

H

HABIBAH, UMMU (2012) HUBUNGAN ANTARA BODY IMAGE DENGAN INTENSITAS PERAWATAN WAJAH DAN TUBUH PADA REMAJA PUTRI DI KLINIK KECANTIKAN MUTIA VIE SKIN CARE JEPARA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

HAFID, MUHAMMAD (2011) HUBUNGAN ANTARA PERSEPSI TERHADAP GAJI DENGAN KEPUASAN KERJA PADA KARYAWAN RESTORAN X SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

HAMIDAH, RISTA NUR (2021) HUBUNGAN REGULASI EMOSI DENGAN TINGKAT STRES PADA ORANG TUA DALAM MENDAMPINGI PEMBELAJARAN JARAK JAUH ANAK USIA SEKOLAH DASAR DI MASA PANDEMI. Undergraduate thesis, Universitas Islam Sultan Agung.

HANIMAH, ADZRO’ (2016) PENGARUH MENGHAFAL AL-QUR’AN TERHADAP KECERDASAN EMOSIONAL ANAK USIA DINI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

HANUM, ALFIRA (2012) HUBUNGAN ANTARA PERSEPSI TERHADAP DUKUNGAN SOSIAL SUAMI DENGAN KECEMASAN MENJELANG MENOPAUSE PADA WANITA DI PERUMAHAN GRIYA BHAKTI PRAJA MANGUNJIWAN DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

HAPSARI, DYAH NAWANG (2010) HUBUNGAN ANTARA MASA KERJA DEN GAN MORIV ASI KERJA PADA PERA WAT RUMAH SAKIT DAERAH R. SOEDJATI PURWODADI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

HASKORO, SINDHU ADI (2023) HUBUNGAN EFIKASI DIRI DENGAN KECEMASAN TERHADAP MASA DEPAN MAHASISWA TEKNIK SIPIL DAN MANAJEMEN UNDIP ANGKATAN 2018. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

HERNAWATI, LILIEK (2012) HUBUNGAN ANTARA PERSEPSI TERHADAP KESELAMATAN DAN KESEHATAN KERJA(K3) DENGAN KOMITMEN ORGANISASI PADA KARYAWAN SENTRAL TELEPON OTOMAT (STO)SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Hadaningrum, Rina (2017) HUBUNGAN ANTARA DUKUNGAN SOSIAL ORANG TUA DAN DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN KONSEP DIRI PADA REMAJA TUNADAKSA DI YPAC PROF. DR. SOEHARSO SURAKARTA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Hadi, Sholihul (2016) Hubungan Antara Konformitas Dengan Gaya Hidup Hedonisme di Pondok Pesantren. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Hakim, Helmy Arijuddin (2020) HUBUNGAN POLA ASUH PERMISIF TERHADAP KEMANDIRIAN ANAK BERKEBUTUHAN KHUSUS (TUNA GRAHITA). Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Hakim, Rub’an Luqman (2012) KEMAMPUAN MENYESUAIKAN DIRI dan INTERAKSI MASYARAKSAMIN(SEDULUR SIKEP) TERHADAP PERKEMBANGAN ZAMA(Studi Etnografi Masyarakat Samin Desa Baturejo, Sukolilo, Pati). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Halimah, Nur (2017) HUBUNGAN ANTARA POLA ASUH PERMISIF DAN KONFORMITAS DENGAN PERILAKU AGRESIF PADA REMAJA PRIA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Halimah, Yunita Diah Ayu Nur (2023) HUBUNGAN ANTARA KECERDASAN EMOSIONAL DAN EFIKASI DIRI DENGAN KEMATANGAN KARIR PADA SISWA DI SMA X. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Halisa, Salma Nur (2023) KRISIS IDENTITAS PASCA KEMATIAN ORANG TUA PADA MAHASISWA: (SEBUAH) ANALISIS FENOMENOLOGIS INTERPRETATIF. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Handayani, Ninuk Dwi Puspa (2021) HUBUNGAN ANTARA PEMAAFAN DIRI DENGAN KESEJAHTERAAN PSIKOLOGIS PADA NARAPIDANA PEREMPUAN DI LAPAS KELAS IIA KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Handono, Yosana Okter (2016) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU SEKSUAL REMAJA LAKI LAKI DALAM BERPACARAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Hanggraeni, Evi Latifa (2014) HUBUNGAN ANTARA KONSEP DIRI DAN TIPE KEPRIBADIAN INTROVERT DENGAN KECEMASAN BERKOMUNIKASI DI DEPAN UMUM PADA MAHASISWA UNISSULA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Hani, Ummu (2018) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN EFIKASI DIRI DENGAN COPING STRESS PADA DOKTER GIGI MUDA (Co-ass) Di RUMAH SAKIT ISLAM GIGI DAN MULUT SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Hanim Islahia, Fatikha (2023) HUBUNGAN EFIKASI DIRI KEPUTUSAN KARIR DENGAN PENGAMBILAN KEPUTUSAN KARIR PADA SISWA SMA KELAS XII. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Happywidinata, Raafi (2019) HUBUNGAN ANTARA KEMATANGAN EMOSI DENGAN PENGAMBILAN KEPUTUSAN PADA AKTIVIS DI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Hapsari, Dian Arya (2022) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN KRISIS SEPEREMPAT HIDUP PADA DEWASA AWAL DI KELURAHAN PUDAK PAYUNG KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Hapsari, Wenny Tri (2017) HUBUNGAN ANTARA KONFORMITAS DAN GAYA HIDUP HEDONIS DENGAN KEPUTUSAN PEMBELIAN PERALATAN MAKE-UP DAN PAKAIAN DI KALANGAN MAHASISWI FAKULTAS ILMU KEPERAWATAN UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Harasuna, Frida Zakiyya (2019) HUBUNGAN ANTARA BEBAN KERJA DAN EFIKASI DIRI DENGAN STRES KERJA PADA AGEN CALL CENTER X PT. XY SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Hardiansyah, Dio (2019) HUBUNGAN ANTARA MOTIVASI KERJA DENGAN PRODUKTIVITAS KERJA PADA KARYAWAN PR SUKUN DI KUDUS. Undergraduate thesis, Universitas Islam Sultan Agung.

Hardiningsih, Ryza Desma (2019) HUBUNGAN ANTAA IKLIM SEKOLAH DAN HARGA DIRI DENGAN PERILAKU BULLYING REMAJA. Undergraduate thesis, Universitas Islam Sultan Agung.

Harjito, Mahendra Bagus (2019) HUBUNGAN ANTARA PERSEPSI TERHADAP KESEHATAN DENGAN PERILAKU MEROKOK PADA MAHASISWA KEPERAWATAN DAN KEDOKTERAN UMUM UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Hartanti, Endang Lusiana (2019) HUBUNGAN ANTARA PENGGUNAAN MEDIA SOSIAL DENGAN PERILAKU PROSOSIAL PADA SISWA SMK NEGERI 1 PAKIS AJI JEPARA. Undergraduate thesis, Universitas Islam Sultan Agung.

Harum, Nur Fauziyah (2020) HUBUNGAN ANTARA EMPATI DENGAN PERILAKU AGRESIVITAS PADA SISWA SMK X DI KABUPATEN PATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Haryuningtyas Asmara, Nadia (2023) HUBUNGAN ANTARA EDUKASI SEKSUAL ORANGTUA DENGAN PERILAKU SEKSUAL REMAJA BERPACARAN DI SMK “X”. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Hasnah Wildani, Mila (2022) HUBUNGAN ANTARA PERSEPSI TERHADAP GAYA KEPEMIMPINAN TRANSFORMASIONAL DENGAN KEPUASAN KERJA DI PT SINAR TIGA DEWI DI KOTA DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Hasriningrum, Ratnasari (2022) HUBUNGAN ANTARA PUSAT KENDALI INTERNAL DENGAN KEMATANGAN KARIR PADA SISWA-SISWI KELAS XII SMA NEGERI 1 WELAHAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Hastu, Try Ardhi Nugraha (2021) HUBUNGAN ANTARA KUALITAS KEHIDUPAN KERJA DENGAN KINERJA GURU HONORER DI KECAMATAN GENUK KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Hastuti, Aisyah Putri (2017) HUBUNGAN ANTARA RESOLUSI KONFLIK DENGAN KEPUASAN PERNIKAHAN PADA ISTRI DI DESA “P” KABUPATEN TEMANGGUNG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Hatmojo, Irsalina Safira (2019) HUBUNGAN DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN PENYESUAIAN DIRI SANTRI PONDOK PESANTREN PUTRA-PUTRI WASILATUL HUDA KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Heri, Heri (2017) HUBUNGAN ANTARA KELEKATAN AMAN DENGAN PERILAKU ASERTIF PADA MAHASISWA PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Herianto, Rahmat Nabila (2019) HUBUNGAN ANTARA KOMUNIKASI INTERPERSONAL DENGAN PENGAMBILAN KEPUTUSAN PADA PIMPINAN LEMBAGA KEMAHASISWAAN DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Herlina, Sunia (2023) HUBUNGAN FINANCIAL BEHAVIOR DAN KONTROL DIRI DENGAN DISSAVING BEHAVIOR PENGGUNA LAYANAN SHOPEE PAYLATER PADA MAHASISWA FAKULTAS EKONOMI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Herman, Herman (2016) HUBUNGAN EFIKASI DIRI DAN DUKUNGAN SOSIAL TEMA SEBAYA DENGAN PENYESUAIAN DIRI MAHASISWA BARU DALAM PERKULIAHAN (Studi Kasus Mahasiswa Baru Program Studi Pendidikan Dokter UNISSULA Angkatan 2015). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Herman, Herman (2016) HUBUNGAN EFIKASI DIRI DAN DUKUNGAN SOSIAL TEMA SEBAYA DENGAN PENYESUAIAN DIRI MAHASISWA BARU DALAM PERKULIAHAN (Studi Kasus Mahasiswa Baru Program Studi Pendidikan Dokter UNISSULA Angkatan 2015). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Hi. Ali, Sitna Morviyani (2023) HUBUNGAN CULTURE SHOCK DAN RESILIENSI DENGAN ADAPTASI SOSIAL PADA MAHASISWA RANTAU. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Hidayah, Faizatul (2020) HUBUNGAN ANTARA KONFORMITAS DAN STRES AKADEMIK DENGAN PROKRASTINASI AKADEMIK PADA MAHASISWA TINGKAT AKHIR YANG MENYUSUN SKRIPSI DI FAKULTAS TEKNOLOGI INDUSTRI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Hidayah, Fajri (2017) HUBUNGAN ANTARA KECERDASAN EMOSIONAL DAN ADVERSITY QUOTIENT PADA MAHASISWA GELAR GANDA DAN REGULER UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Hidayanti, Nur Isma (2017) HUBUNGAN ANTARA STRES KERJA DENGAN TURNOVER INTENTION PADA KARYAWAN “Lxxx” PT. “XZ” SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Hidayat, Zidan (2020) HUBUNGAN ANTARA DUKUNGAN DUKUNGAN SOSIAL DAN OPTIMISME TERHADAP SUBJECTIVE WELL BEING PADA REMAJA DI PANTI ASUHAN AT-TAQWA TEMBALANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Hidayati, Annisa (2021) PEMAAFAN DIRI MANTAN HOMOSEKSUAL (LESBIAN). Undergraduate thesis, Universitas Islam Sultan Agung.

Hidayatiningsih, Wulan (2020) HUBUNGAN ANTARA KEDISIPLINAN DENGAN PRESTASI BELAJAR SMA X. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Himmah, Faaiqotul (2020) HUBUNGAN ANTARA MOTIVASI INTRINSIK DAN KEMATANGAN EMOSI DENGAN PENGAMBILAN KEPUTUSAN MAHASISWA TAHFIDZ YANG TINGGAL DI PONDOK PESANTREN MADROSATUL QUR’ANIL AZIZIYYAH. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Himmah, Faaiqotul (2019) HUBUNGAN ANTARA MOTIVASI INTRINSIK DAN KEMATANGAN EMOSI DENGAN PENGAMBILAN KEPUTUSAN MAHASISWA TAHFIDZ YANG TINGGAL DI PONDOK PESANTREN MADROSATUL QUR’ANIL AZIZIYYAH. Undergraduate thesis, Universitas Islam Sultan Agung.

Himmah, Nafi’atul (2017) HUBUNGAN ANTARA ORIENTASI MASA DEPAN DAN DAYA JUANG DENGAN MOTIVASI KERJA PADA MAHASISWA TINGKAT AKHIR. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Himmatul, Ulya (2022) HUBUNGAN ANTARA DUKUNGAN SOSIAL ORANGTUA DENGAN KENAKALAN REMAJA SEKOLAH. Undergraduate thesis, Universitas Islam Sultan Agung.

Hozahito, Pridam (2017) HUBUNGAN ANTARA KESEJAHTERAAN PSIKOLOGIS DENGAN KEPRIBADIAN TANGGUH PADA MASYARAKAT YANG TERKENA ROB BANJIR DI KALIGAWE KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Huda, Mis Bahul (2017) HUBUNGAN ANTARA KONFORMITAS DENGAN KENAKALAN REMAJA PADA SISWA KELAS XI SMK SULTAN FATAH DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Huda, Zaenatul (2021) HUBUNGAN KONTROL DIRI DENGAN KECANDUAN GAME ONLINE PADA REMAJA SMA X. Undergraduate thesis, Universitas Islam Sultan Agung.

Husna, Farida (2019) HUBUNGAN ANTARA KONTROL DIRI DENGAN PROKRASTINASI AKADEMIK PADA SISWA SMA ISLAM SULTAN AGUNG 1 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Husnawati, Elok Farida (2017) EFEKTIVITAS PELATIHAN KOIN JIWA DALAM MENURUNKAN STIGMA TERHADAP ORANG DENGAN GANGGUAN JIWA PADA MAHASISWA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Huwaida, Nisrina (2021) HUBUNGAN ANTARA REGULASI EMOSI DENGAN PERILAKU MEMAAFKAN PADA REMAJA DENGAN ORANGTUA YANG BERCERAI. Undergraduate thesis, Universitas Islam Sultan Agung.

I

ISLANI, FITRI DIAN (2023) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KECEMASAN MAHASISWA DALAM MENYELESAIKAN SKRIPSI DI FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Ichwan, Muhammad (2023) HUBUNGAN ANTARA SIFAT PERFEKSIONIS DENGAN PROKRASTINASI AKADEMIK PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG PADA ANGKATAN 2019 – 2021. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Ifania, Ofi Nabit (2021) HUBUNGAN ANTARA OPTIMISME DENGAN ADVERSITY QUOTIENT PADA MAHASISWA UNIVERSITAS ISLAM NAHDLATUL ULAMA JEPARA YANG BEKERJA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ihsani, Nisa Fadillah Nurul (2015) LOYALITAS PENGGUNA MASKAPAI GARUDA INDONESIA DITINJAU DARI GAYA HIDUP BELIEVERS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ilma, Alif Faiza Maftahul Nurul (2021) HUBUNGAN ANTARA PERSEPSI TERHADAP KUALITAS BARANG DENGAN MINAT BELI ONLINE PADA MASYARAKAT KECAMATAN TAYU DI KOTA PATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ilma, Wahyu Rahmadita (2023) HUBUNGAN ANTARA KONTROL DIRI DENGAN CYBERSLACKING PADA SISWA KELAS XI SMA X DEMAK. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Inawati, Eni (2023) HUBUNGAN TINGKAT FANATISME TERHADAP PERILAKU KONSUMTIF REMAJA PENGGEMAR KOREAN POP KOMUNITAS NCT FANS CLUB (NCTZEN) DI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Indraswari, Yuwanda (2023) HUBUNGAN ANTARA KEPRIBADIAN DAN SPIRITUALITAS DENGAN KEBAHAGIAAN PADA KARYAWAN DI PT. TRIANGLE MOTORINDO. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Indrayanti, Yenny Evalin (2015) KONSEP CINTA LESBIAN DI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Indriani, Defi (2015) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN KONFLIK PERAN GANDA TERHADAP KESEJAHTERAAN PSIKOLOGIS KARYAWATI PT. SC ENTERPRISES SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Indriasti, Lis (2014) MASIHKAH MENGUMBAR DIRI SAAT KITA SADAR DIRI? (Studi Hubungan antara Objective Self Awareness dengan Self Disclosure melalui Facebook pada Mahasiswa X). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Indriyah, Siti Lina (2022) HUBUNGAN ANTARA INTENSITAS MENGAKSES SITUS PORNOGRAFI DENGAN PERILAKU SEKSUAL PRANIKAH PADA REMAJA LAKI-LAKI YANG BERPACARAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Indriyani, Nika Ayu (2022) HUBUNGAN ANTARA DUKUNGAN SOSIAL SUAMI TERHADAP KONTROL DIRI IBU DALAM PENGASUHAN ANAK DI DESA PAMONGAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Intan Zalzabila Putri, Fadhilah (2022) HUBUNGAN ANTARA ORGANIZATIONAL CITIZENSHIP BEHAVIOR (OCB) DAN MOTIVASI KERJA DENGAN KINERJA KARYAWAN BPR CATUR ARTHA JAYA KUDUS. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Irfandi, Muhammad (2015) HUBUNGAN ANTARA KONSEP DIRI DAN KONFORMITAS DENGAN PERILAKU KONSUMTIF MAHASISWA DALAM MEMBELI SMARTPHONE TERBARU. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Irfatin, Laila (2021) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU KONSUMTIF PEMBELIAN PRODUK SKINCARE SCARLETT PADA MAHASISWI DI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Irfiana, Diah (2018) PENGARUH PERSEPSI HUKUMAN TERHADAP TINGKAT KEPATUHAN MASYARAKAT DALAM BERKENDARA YANG AMAN DI KOTA DEMAK. Undergraduate thesis, Fakultas Ekonomi UNISSULA.

Irsyady, Farida (2017) HUBUNGAN ANTARA KECERDASAN EMOSI DENGAN PENYESUAIAN SOSIAL PADA KELAS UNGGULAN DI MADRASAH ALIYAH NEGERI 2 KUDUS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Irwan, Irwan (2017) HUBUNGAN ANTARA KETAKUTAN AKAN KEGAGALAN DAN PERILAKU MENYONTEK SAAT UJIAN PADA MAHASISWA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Isharyoto, Chandra Maulidannisa (2021) HUBUNGAN ANTARA ADVERSITY QUOTIENT DENGAN KECEMASAN DALAM MENGHADAPI DUNIA KERJA PADA MAHASISWA TINGKAT AKHIR DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Islami, Deviyanti Ajeng Nor (2017) HUBUNGANAGREEABLENESS(SOCIAL ADAPTABILITY) DAN KONFORMITAS DENGAN KEBUTUHAN AKAN RASA AMAN PADA ANGGOTA KOMUNITAS PUNK DI JAWA TENGAH. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Islamy, Findi Dien (2016) AGRESIVITAS PADA SISWA SMKN 10 di SEMARANG DITINJAU DARI KONFORMITAS TEMAN SEBAYA DAN KONTROL DIRI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ismania, Astrid Refkiearta (2023) HUBUNGAN ANTARA KONTROL DIRI DENGAN PERILAKU KONSUMTIF PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG PENGGUNA E-COMMERCE SHOPEE. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Isnawati, Isnawati (2016) STRES MAHASISWA UNISSULA KETIKA MENYUSUN SKRIPSI DITINJAU DARI MOTIVASI BELAJAR DAN EFIKASI DIRI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Istinadia, Akmalia (2015) HUBUNGAN ANTARA PROBLEM FOCUSED COPING DAN EFIKASI DIRI TERHADAP STRES PRAKTIKUM PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Istiqomah, Istiqomah (2015) HUBUNGAN ANTARA EFIKASI DIRI DAN KEPERCAYAAN DIRI DENGAN KESIAPAN KERJA PADA MAHASISWA TINGKAT AKHIR FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Iswara, Septian Dwi (2020) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN KELELAHAN KERJA PERAWAT YANG BEKERJA DI RUMAH SAKIT PANTIWILASA CITARUM SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Izzuddin, Abdullah Azzam (2019) HUBUNGAN ANTARA KONSEP DIRI DENGAN PERILAKU HIDUP SEHAT PADA MAHASISWA YANG MENGIKUTI ORGANISASI DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

J

JAYA, MUHAMAD HERMAN (2019) HUBUNGAN ANTARA KELEKATAN DENGAN KUALITAS PERSAHABATAN PADA REMAJA SMP ISLAM SULTAN AGUNG 4 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Jamal, Amalia Febriyanti (2023) HUBUNGAN ANTARA FEAR OF MISSING OUT (FoMO) DENGAN PERILAKU PEMBELIAN IMPULSIF PADA SISWA PENGGEMAR K-POP DI SMA NEGERI 10 SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Janet, Della Elvia (2021) HUBUNGAN ANTARA EKSISTENSI DIRI DENGAN PENGUNGKAPAN DIRI MELALUI MEDIA SOSIAL INSTAGRAM PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, Universitas Sultan Agung.

Jannah, Cholifatul (2018) DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN KESEJAHTERAAN PSIKOLOGIS PADA REMAJA SANTRIWATI PENGHAFAL QUR’AN DI PONDOK PESANTREN BUQ DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Jannah, Layli Uzlifatul (2019) KETERAMPILAN SOSIAL DENGAN CELEBRITY WORSHIP PADA K-POP FANS (iKONIC). Undergraduate thesis, Universitas Islam Sultan Agung.

Jannah, Syahria Nur (2016) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN RESILIENSI PADA PENYINTAS BANJIR ROB TAMBAK LOROK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Jannah Munawar, Miftahul (2022) HUBUNGAN ANTARA PEER GROUP RELATIONSHIP DAN KEPERCAYAAN DIRI DENGAN GAYA HIDUP HEDONIS PADA MAHASISWA UNISSULA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Jaya, Muhammad Herman (2020) HUBUNGAN ANTARA KELEKATAN DENGAN KUALITAS PERSAHABATAN PADA REMAJA SMP ISLAM SULTAN AGUNG 4 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Jihadi, Nurmin Fauzi Akbar (2022) HUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN PROBLEM FOCUSED COPING PADA MAHASISWA ORGANISASI DI FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Jihannisa, Febriana (2022) HUBUNGAN ANTARA BODY IMAGE DENGAN PERILAKU DIET PADA MAHASISWA FAKULTAS HUKUM UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

K

KALSUM AZZAHARA, UMMY (2008) HUBUNGAN ANTARA KEPUASAN KONSUMEN DENGAN INTENSI MENGGUNAKAN JASA TRANSPORTASI KERETA API BISNIS FAJAR UTAMA DI WILAYAH SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

KAMILA, AISYAH (2023) HUBUNGAN ANTARA BEBAN KERJA DAN KOMITMEN KARIR TERHADAP WORK LIFE BALANCE DIVISI PENJUALAN PT. SUKUN WARTONO INDONESIA KUDUS. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

KARIMAN, F (2020) HUBUNGAN ANTARA MOTIVASI BELAJAR DENGAN PENYESUAIAN DIRI DALAM PENERAPAN MEDIA BELAJAR E-LEARNING PADA MAHASISWA SEMESTER 5 DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

KASMINTO, KASMINTO (2012) PERSEPSI ANAK JALANAN TERHADAP SEKOLAH(Studi Deskriptif terhadap Anak-Anak Jalanan Binaan Komunitas Satoe Atap). Undergraduate thesis, Fakultas Psikologi UNISSULA.

KArim, Mufti Maulid Ati (2016) PROBLEM FOCUS COPING PADA NARAPIDANA TERVONIS SEUMUR HIDUP DI LAPAS KEDUNGPANE KELAS I SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

KHALIF, ABDUL (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN KEBAHAGIAAN PADA NARAPIDANA DI LAPAS PEREMPUAN KELAS II A SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

KHOIR, DIAN UMMUL (2020) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN KECEMASAN PADA NARAPIDANA LAKI-LAKI YANG MENJELANG MASA BEBAS DI LEMBAGA PEMASYARAKATAN KELAS IA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

KHOIR, DIAN UMMUL (2019) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN KECEMASAN PADA NARAPIDANA LAKI-LAKI YANG MENJELANG MASA BEBAS DI LEMBAGA PEMASYARAKATAN KELAS IA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

KORATRI, AYIANTO (2008) Perbedaan Religiusitas dan Sikap terhadap Budaya Akademik lslami (BUDAI) antara Mahasiswa UNISSULA Yang Sudah Ikut dan Belum Ikut Pelatihan Budaya Akademik lslami (BUDAI). Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Kamila, Azzahra Wilda (2022) HUBUNGAN ANTARA ADIKSI INTERNET DENGAN PEMBELIAN IMPULSIF PADA MAHASISWA UNISSULA PENGGUNA E-COMMERCE SELAMA PANDEMI. Undergraduate thesis, Universitas Islam Sultan Agung.

Kamilina, Puspa (2018) KEKERASAN ANAK DITINJAU DARI POLA ASUH KENABIAN DAN KONTROL DIRI PADA IBU DARI MURID SEKOLAH DASAR “X”. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kamsyar, Wa Ode Risnawati (2017) HUBUNGAN ANTARA KONSEP DIRI DAN DUKUNGAN SOSIAL ORANG TUA DENGAN ORIENTASI MASA DEPAN PADA SISWA KELAS XII SMAN 10 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Karimah, Nashikhatul (2019) INTENSI PENGGUNAAN MEDIA SOSIAL PADA REMAJA DITINJAU DARI KESEPIAN DAN KEBUTUHAN AFILIASI. Undergraduate thesis, Universitas Islam Sultan Agung.

Kartikasari, Restu (2022) HUBUNGAN ANTARA KECERDASAN EMOSIONAL DENGAN MANAJEMEN KONFLIK PADA MAHASISWA UNIVERSITAS X DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Kartini, Nafiah (2014) HUBUNGAN ANTARA PERSEPSI TERHADAP KEADILAN KOMPENSASI DENGAN KETERIKATAN KARYAWAN PADA KARYAWAN ORBIT COMPUTER SYSTEM SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Keniziva, Claufiana Hernz (2023) ISLAMIC HUMAN RESOURCE MANAGEMENT DAN KEPUASAN KERJA PADA KARYAWAN PT. PLN (Persero). Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Keyvi, Annelis (2021) HUBUNGAN ANTARA TRAIT KEPRIBADIAN OPENNESS TO EXPERIENCE TERHADAP QUARTER LIFE CRISIS PADA MAHASISWA TINGKAT AKHIR. Undergraduate thesis, Universitas Sultan Agung.

Khaazanatuzzahra, Putri (2023) HUBUNGAN ANTARA SELF-EFFICACY DENGAN QUARTER LIFE CRISIS PADA MAHASISWA TINGKAT AKHIR DI FAKULTAS EKONOMI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Khafidloh, Naili (2019) HUBUNGAN ANTARA KEBERSYUKURAN DENGAN KESEJAHTERAAN SUBJEKTIF PADA MAHASISWA BARU FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Khafidloh, Naili (2020) HUBUNGAN ANTARA KEBERSYUKURAN DENGAN KESEJAHTERAAN SUBJEKTIF PADA MAHASISWA BARU FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Khairunnisa, Faradhila (2020) HUBUNGAN ANTARA PENERIMAAN DIRI DENGAN KEBERMAKNAAN HIDUP PADA REMAJA DI PANTI ASUHAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Khairunnisa, Nadia Kumala (2019) HUBUNGAN ANTARA DISIPLIN KERJA DAN KEPUASAN KERJA TERHADAP KINERJA PADA KARYAWAN OUTSOURCING PT. X DI KOTA Y. Undergraduate thesis, Universitas Islam Sultan Agung.

Khairunnisa, Nurhayat Marhama (2017) HUBUNGAN ANTARA EFIKASI DIRI DAN KECEMASAN DALAM MENGHADAPI UJIAN DENGAN PERILAKU MENYONTEK PADA MAHASISWA FAKULTAS PSIKOLOGI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Khakimah, Milatul (2017) HUBUNGAN ANTARA GAYA HIDUP DENGAN FANATISME BUDAYA KOREAN POP (K-POP) PADA KOMUNITAS EXO FANS CLUB (EXO-L) SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Khalafiyah, Ghani (2023) HUBUNGAN ANTARA EFIKASI DIRI AKADEMIK DAN PARENTAL PRESSURE DENGAN KECEMASAN MENGERJAKAN SKRIPSI PADA MAHASISWA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Khalillah, Iklil (2023) HUBUNGAN ANTARA REGULASI DIRI DAN EFIKASI DIRI DENGAN PERENCANAAN KARIR PADA LULUSAN SARJANA BARU. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Khalista, Dody Mashadi Nor Ahmad (2017) HUBUNGAN ANTARA RAOS SAMI (RASA SAMA) WEJANGAN KI AGENG SURYOMENTARAM DENGAN KESEJAHTERAAN PSIKOLOGIS PADA WARGA DESA BALONG, TIMBULHARJO KECAMATAN SEWON KABUPATEN BANTUL PROVINSI DAERAH ISTIMEWA YOGJAKARTA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Khamia Mu’tamiroh, Namira (2022) HUBUNGAN ANTARA SELF EFFICACY DAN ACADEMIC BURNOUT PADA MAHASISWA PRAKTIKUM FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Khamidah, Siti (2020) KEPUASAN PERNIKAHAN PADA ISTRI YANG MENGALAMI KEHAMILAN DI LUAR NIKAH SAAT USIA REMAJA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Kharis, Naufal Haidar (2019) HUBUNGAN ANTARA KUALITAS PELAYANAN DENGAN KEPUASAN KONSUMEN PENGGUNA GO-JEK PADA MAHASISWA FAKULTAS PETERNAKAN UNIVERSITAS DIPONEGORO. Undergraduate thesis, Universitas Islam Sultan Agung.

Kharis, Naufal Haidar (2020) HUBUNGAN ANTARA KUALITAS PELAYANAN DENGAN KEPUASAN KONSUMEN PENGGUNA GO-JEK PADA MAHASISWA FAKULTAS PETERNAKAN UNIVERSITAS DIPONEGORO. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Khasanah, Faidatul (2017) HUBUNGAN ANTARA INTENSITAS KOMUNIKASI DENGAN KEPUASAN PERNIKAHAN PADA ISTRI YANG BERHUBUNGAN JARAK JAUH. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Khasanah, Fitriatun (2015) PENERIMAAN DIRI PADA PEREMPUAN PEKERJA SEKS PENDERITA HIV/AIDS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Khasanah, Minfaatun (2023) HUBUNGAN POLA ASUH OTORITER DAN KECEMASAN SOSIAL PADA SISWA SMP N 2 DONOROJO. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Khitobun, Khotbi (2020) HUBUNGAN ANTARA KONSEP DIRI DENGAN PERILAKU KONSUMTIF PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG (UNISSULA) SEMARANG ANGKATAN 2016. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Khodijah, Syafina (2023) HUBUNGAN ANTARA FEAR OF FAILURE DAN PERSEPSI HARAPAN ORANG TUA TERHADAP ACADEMIC BURNOUT PADA MAHASISWA AKHIR PROGRAM STUDI EKONOMI ISLAM FAKULTAS EKONOMIKA DAN BISNIS UNIVERSITAS DIPONEGORO SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Khoeriyah, Widatul Nur (2017) HUBUNGAN ANTARA POLA ASUH OTORITATIF DENGAN KEBERHASILAN TOILET TRAINING PADA BALITA DI DUSUN SENDEN JATIJAJAR. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Khofif, Ahmad (2012) HUBUNGAN ANTARA KONFORMITAS DENGAN PERILAKU MINUM-MINUMAN KERAS PADA MAHASISWA YANG TINGGAL DI RUMAH KOST PERUMAHAN GENUK INDAH SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Khoiriyaturrosidah, Annisa (2022) HUBUNGAN ANTARA KEPERCAYAAN DIRI DAN DUKUNGAN SOSIAL ORANG TUA DENGAN KECEMASAN SISWA MENGHADAPI SELEKSI MASUK PERGURUAN TINGGI NEGERI PADA SISWA MAN 02 PATI. Undergraduate thesis, Universitas Islam Sultan Agung.

Khoirunisa, Zunita (2020) HUBUNGAN ANTARA GAYA KEPEMIMPINAN TRANSFORMASIONAL DENGAN KINERJA KARYAWAN PT. GEMAH MAKMUR SEJAHTERA, UNGARAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Khoirunisa, Zunita (2019) HUBUNGAN ANTARA GAYA KEPEMIMPINAN TRANSFORMASIONAL DENGAN KINERJA KARYAWAN PT. GEMAH MAKMUR SEJAHTERA, UNGARAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Khoirunnisa’, Rafika (2021) PERAN TIPE KEPRIBADIAN EKSTROVERT DAN KONSEP DIRI TERHADAP GAYA HIDUP HEDONISME PADA MAHASISWA TRAVELER. Undergraduate thesis, Universitas Islam Sultan Agung.

Kholida, Salma (2020) PENERIMAAN DIRI PADA KORBAN KEKERASAN SEKSUAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Kholida, Salma (2019) PENERIMAAN DIRI PADA KORBAN KEKERASAN SEKSUAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Khotimah, Ida Nur (2022) TAHAPAN PEMAAFAN PADA INDIVIDU DEWASA AWAL YANG MENJADI KORBAN KEKERASAN ORANG TUA. Undergraduate thesis, Universitas Islam Sultan Agung.

Khusnayein, Ikhda (2019) HUBUNGAN ANTARA REGULASI DIRI DALAM BELAJAR DAN DUKUNGAN SOSIAL TEMAN TERHADAP PROKRASTINASI AKADEMIK PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung.

Kinesthi, Nimas Putri (2020) HUBUNGAN ANTARA KEPRIBADIAN KETANGGUHAN DENGAN PROBLEM FOCUSED COPING PADA GURU SEKOLAH LUAR BIASA B DAN C DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Kinesthi, Nimas Putri (2019) HUBUNGAN ANTARA KEPRIBADIAN KETANGGUHAN DENGAN PROBLEM FOCUSED COPING PADA GURU SEKOLAH LUAR BIASA B DAN C DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Komalasari, Nur Anggita (2017) HUBUNGAN FATHERING DALAM PENGASUHAN DENGAN KEPERCAYAAN DIRI REMAJA PEREMPUAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kordin, Karlianti (2015) PENYESUAIAN DIRI DI LINGKUNGAN KAMPUS PADA MAHASISWA PSIKOLOGI PENERIMA BEASISWA CERDAS SULTRAKU DALAM KAITANNYA DENGAN KECERDASAN EMOSI DAN KEMANDIRIAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Koriah, Siti (2022) HUBUNGAN PENERIMAAN DIRI DENGAN QUARTER LIFE CRISIS PADA FRESH GRADUATE FAKULTAS PSIKOLOGI UNISSULA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Kristanti, Devi Wahyu (2021) HUBUNGAN ANTARA KONSEP DIRI DENGAN KECEMASAN SOSIAL PADA REMAJA DI SMA N 1 PURWODADI. Undergraduate thesis, Universitas Sultan Agung.

Kristiyono, Ermanier (2015) HUBUNGAN ANTARA EFIKASI DIRI DAN POLA ASUH PERMISIF DENGAN KECANDUAN GAME ONLINE PADA REMAJA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kurnia, Intan (2018) HUBUNGAN ANTARA PENERIMAAN DIRI DENGAN PENYESUAIAN SOSIAL PADA MAHASISWA BARU DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Ekonomi UNISSULA.

Kurniadhi, Dimas Rachmad (2021) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN MOTIVASI BELAJAR PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Kurniasari, Maya (2017) TINJAUAN KRIMINOLOGIS TERHADAP FREKUENSI TINDAK PIDANA PERJUDIAN DI WILAYAH HUKUM KABUPATEN PATI (Studi di Polres Pati). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kurniasih, Dwi Eri (2020) KONFORMITAS TEMAN SEBAYA DAN RELIGIUSITAS TERHADAP GAYA HIDUP HEDONISME DI SMA “X”. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Kurniati, Indri (2023) HUBUNGAN ANTARA PRIVASI DAN KESEPIAN TERHADAP PENGUNGKAPAN DIRI PADA PENGGUNA INSTAGRAM. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Kurniawan, Dani (2017) PENGARUH PENDIDIKAN LINGKUNGAN TERHADAP PERILAKU PROLINGKUNGAN PADA PEDAGANG KAKI LIMA DI DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kurniawan, Fajar (2018) HUBUNGAN ANTARA KUALITAS PELAYANAN DENGAN KEPUASAN PELANGGAN GO JEK PADA MAHASISWA PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kurniawan, Fathoni Dwi (2016) HUBUNGAN ANTARA PERSEPSI TERHADAP RISIKO DENGAN AGGRESSIVE DRIVING PADA SOPIR BUS AKAP. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kurniawan, Hanif Kukuh (2022) HUBUNGAN ANTARA EFIKASI DIRI DAN KETEKUNAN AKADEMIK DI ERA PANDEMI PADA SISWA SEKOLAH MENENGAH ATAS. Undergraduate thesis, Universitas Islam Sultan Agung.

Kusmawardani, Dyah Arie (2015) HUBUNGAN ANTARA EFIKASI DIRI DENGAN MOTIVASI MELANJUTKAN STUDI PASCASARJANA PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kustinah, Kustinah (2014) HUBUNGAN ANTARA MINAT WIRAUSAHA DENGAN KEPERCAYAAN DIRI PADA SISWA SMK PERINTIS 29 UNGARAN TAHUN 2013. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kusum, M. Galih Jati (2018) HUBUNGAN ANTARA KUALITAS PRODUK DAN KUALITAS PELAYANAN TERHADAP KEPUASAN KONSUMEN DI PT. ASTRA HONDA MOTOR CENTER KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kusuma, Edi Kurniadi (2020) HUBUNGAN ANTARA MANAJEMEN WAKTU DENGAN REGULASI DIRI PADA MAHASISWA ANGKATAN 2017 FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Kusuma, Edi Kurniadi (2019) HUBUNGAN ANTARA MANAJEMEN WAKTU DENGAN REGULASI DIRI PADA MAHASISWA ANGKATAN 2017 FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Kusumaningrum, Fitria Dian (2019) PENGARUH WARNA CANGKIR TERHADAP PERSEPSI CITA RASA MINUMAN KOPI PADA MAHASISWA ANGKATAN 2018 FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Kusumaningrum, Sukma Hayu (2021) HUBUNGAN ANTARA DUKUNGAN KELUARGA DENGAN KEMATANGAN KARIR DI SMA NEGERI 1 PURWODADI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Kusumastuti, Candra Ayu (2017) HUBUNGAN ANTARA RELIGIUSITAS DENGAN KEBERMAKNAAN HIDUP NARAPIDANA DI LEMBAGA PEMASYARAKATAN (LAPAS) KELAS I SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Kusumawati, Intan Ayu (2023) HUBUNGAN ANTARA RELIGIUSITAS DENGAN PERILAKU ALTRUISME PADA REMAJA DI PONDOK PESANTREN MATA AIR KAJEN PATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

L

LASIANI, FARIKHA (2007) PERBEDAAN KOPING STRES DITINJAU DARI TIPE KEPRIBADIAN PADA SISWA KELAS XI SMA AL-FATAH SEMARANG DAN MAN KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung.

LESTARI, SANTI PUJI (2021) TERTAWA DI ATAS PENDERITAAN ORANG LAIN, NORMALKAH? (HUBUNGAN ANTARA HARGA DIRI DAN KONFORMITAS DENGAN SCHADENFREUDE PADA MAHASISWA PSIKOLOGI UNIVERSITAS X SEMARANG). Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

LUBIS, MUHAMMAD SYAH JALAL (2021) HUBUNGAN ANTARA KUALITAS PELAYANAN DENGAN KEPUASAN KONSUMEN GRAB PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Laila, Izzatul (2023) RESILIENSI PADA ISTRI YANG BELUM MEMILIKI ANAK DENGAN USIA PERNIKAHAN 5 TAHUN KE ATAS. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Lailani, Raeda Nur (2019) EFEKTIVITAS TERAPI KILAT DHUHA (DZIKIR DAN SHOLAT DHUHA) DALAM MENURUNKAN TINGKAT KECEMASAN PADA NARAPIDANA WANITA MENJELANG MASA BEBAS DI LAPAS WANITA KELAS II SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Laili, Fatma Nur (2018) HUBUNGAN ANTARA PERSEPSI KEADILAN KOMPENSASI DAN GAYA KEPEMIMPINAN TRANSFORMASIONAL DENGAN KETERLIBATAN KARYAWAN PT. HARTONO ISTANA TEKNOLOGI SAYUNG DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Langit, Dyah Ayu Sekar (2016) KECEMASAN TERHADAP KEMATIAN DITINJAU DARI KONTROL DIRI DAN JENIS KELAMIN PADA DEWASA MADYA DI DESA M KABUPATEN TEGAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Larasati, Anisa Rista (2019) Hubungan Antara Kesadaran Diri dan Efikasi Diri Dengan Prokrastinasi Akademik Pada Mahasiswa Angkatan 2016 Universitas Islam Sultan Agung Semarang. Undergraduate thesis, Universitas Islam Sultan Agung.

Larasati, Gandhes Putri (2022) HUBUNGAN ANTARA STRES PENGASUHAN DENGAN PERILAKU AGRESIF PADA ORANG TUA SISWA SEKOLAH DASAR DI MASA PEMBELAJARAN DARING. Undergraduate thesis, Universitas Islam Sultan Agung.

Lathifah, Zulfa Nisaul (2019) HUBUNGAN ANTARA OPTIMISME DAN DUKUNGAN SOSIAL DENGAN COPING STRESS PADA MAHASISWA YANG SEDANG MENYUSUN SKRIPSI DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Latifatul Fiqroh, Siti (2022) HUBUNGAN ANTARA POLA ASUH OTORITER TERHADAP KEMATANGAN EMOSI PADA SANTRIWATI PONDOK PESANTREN AL MUBAROK MRANGGEN DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Latorumo, Mohammad Ervin (2016) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN KECEMASAN PADA SAAT PRESENTASI PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Lazuardi, Septino Restu Nur (2017) HUBUNGAN ANTARA MOTIVASI KERJA DENGAN ADVERSITY QUOTIENT PADA PEGAWAI DESA DI KECAMATAN BULAKAMBA KABUPATEN BREBES. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Legi, Dinda Putri Hana (2023) HUBUNGAN WELAS ASIH DIRI (SELF COMPASSION) DENGAN KRISIS HIDUP SEPEREMPAT ABAD (QUARTER LIFE CRISIS) PADA LULUSAN BARU (FRESHGRADUATES). Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Legowati, Satria Puri (2017) HUBUNGAN ANTARA CITRA MEREK DAN LOYALITAS PELANGGAN DENGAN MINAT MEMBELI KOSMETIK PADA REMAJA PUTRI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Lestari, Anne Putri (2017) HUBUNGAN ANTARA KONTROL DIRI DENGAN PERILAKU KONSUMTIF PADA SISWA SMA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Lestari, Intan Ayu (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL KELUARGA DAN STRATEGI KOPING TERHADAP KUALITAS HIDUP ODHA (ORANG DENGAN HIV/AIDS). Undergraduate thesis, Universitas Islam Sultan Agung.

Lestari, Putri Novi (2020) HUBUNGAN ANTARA RELIGIUSITAS DENGAN KEBERMAKNAAN HIDUP PADA MUALAF DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Lestari, Ratna Sri Ayu (2022) HUBUNGAN ANTARA MOTIVASI KERJA DENGAN KONFLIK PERAN GANDA WANITA SEBAGAI GURU DI KECAMATAN SIRAMPOG KABUPATEN BREBES. Undergraduate thesis, Universitas Islam Sultan Agung.

Lestari, Wati (2023) STUDI KORELASI MANAJEMEN DIRI DENGAN PRESTASI BELAJAR MATEMATIKA KELAS X & XI. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Liliana, Fatikhah (2016) HUBUNGAN ANTARA KONSEP DIRI DAN KEPERCAYAAN DIRI DENGAN MINAT MEMBELI BARANG BERMERK PADA MAHASISWA FAKULTAS KEDOKTERAN UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Lingga Dewi, Elisa (2022) HUBUNGAN ANTARA INDONESIAN VALUES DENGAN RESILIENSI PADA ANGGOTA BIPOLAR CARE INDONESIA SIMPUL SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Lintang Rizka Mutiara, Cahyaning (2022) GAMBARAN SELF-COMPASSION PADA REMAJA PENYINTAS BULLYING. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Lizamah, Lizamah (2007) HUBUNGAN ANTARA KONSEP DIR.I DAN SELF-REGULATION DEN GAN PROKRASTINASI AKADEMIK P ADA MAHASISWA FAKULTAS EKONOMI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Lutfiyah, Lutfiyah (2020) HUBUNGAN ANTARA KOMUNIKASI INTERPERSONAL DENGAN KEHARMONISAN PERNIKAHAN PADA WANITA USIA MUDA YANG DIJODOHKAN DI KOTA TEGAL KECAMATAN PEKAUMAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Lutviana, Prasiska Devi (2015) HUBUNGAN BODY IMAGE DAN DUKUNGAN SOSIAL DENGAN PERILAKU DIET PADA MAHASISWI FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

M

MAGHFIROH, MAGHFIROH (2004) HUBUNGAN ANTARA PERSEPSI POLA ASUH OTORITER DENGAN KECENDERUNGAN PERILAKU AGRESI PADA REMA.JA PRIA SISWA KELAS I DAN II SMU ISLAM SULTAN AGUNG 3 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

MARLIA, EL VIZA (2004) MINAT MEMBELI TELEPON GENGGAM DI KAW ASAN PLASA SIMPANG LIMA DITINJAU DARI HARGA DIRI DAN PENDIDIKAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

MASTI HANDAYANI, HASTA NINGRUM (2003) PERBEDAAN PERILAKU PROSOSIAL ANTARA REMAJA YANG MEMILIKI ORANG TUA LENGKAP DENGAN REMAJA YANG MEMILIKI ORANG TUA TUNGGAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

MASYITHOH, UMMY (2014) HUBUNGAN ANTARA GAYA HIDUP HEDONIS DENGAN PERILAKU KONSUMTIF REMAJA PUTRI DI MADRASAH ALIYAH NEGERI BABAKAN KABUPATEN TEGAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

MAULIDA, NISRINA ISNA (2023) HUBUNGAN ANTARA PROBLEM FOCUSED COPING TERHADAP BURNOUT AKADEMIK PADA MAHASISWA SEMESTER AKHIR FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

MAYA FARIDIYANTI, SILVYA (2023) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN KECEMASAN DALAM MENYUSUN SKRIPSI PADA MAHASISWA FAKULTAS USHULUDDIN DAN DAKWAH UIN RADEN MAS SAID SURAKARTA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

MEILINA, NUR ALIFIA (2022) HUBUNGAN ANTARA KESEPIAN DENGAN SELFIE-LIKING PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung.

MEYLENNY, TITIS DWI (2012) HUBUNGAN ANTARA PENERIMAN DIRI DENGAN PENYESUAIAN DIRI PADA REMAJA PANTI ASUHAN IKHLASUL AMAL SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

MUALIFFAH, ISQI CHIKITA (2020) HUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN EFIKASI DIRI PADA SANTRIWATI PENGHAFAL AL-QUR’AN DI PONPES DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

MUBAROK, YASIR (2020) HUBUNGAN ANTARA KOHESIVITAS KELOMPOK DENGAN KEMALASAN SOSIAL PADA ORGANISASI PMII UNISSULA (Pada Anggota Organisasi PMII Unissula). Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

MUBAROK, YASIR (2019) HUBUNGAN ANTARA KOHESIVITAS KELOMPOK DENGAN KEMALASAN SOSIAL PADA ORGANISASI PMII UNISSULA (Pada Anggota Organisasi PMII Unissula). Undergraduate thesis, Universitas Islam Sultan Agung.

MUTHIA, NIA NAUVAL (2014) HUBUNGAN ANTARA STRES KERJA DENGAN KEPUASAN KERJA PADA KARYAWAN CV. BAROKAH ABADI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

MU’ASHOMAH, HIKAYATUL (2012) HUBUNGAN KONSEP DIRI POSITIF DENGAN KECEMASAN MENJELANG UJIAN NASIONAL PADA SISWA SMA SULTAN AGUNG DI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Maemunah, Siti (2015) RESILIENSI IBU RUMAH TANGGA YANG MEMILIKI ANAK AUTIS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Maghfiroh, Mawaddatul (2023) HUBUNGAN ANTARA NARSISME DENGAN MOTIVASI SELFIE POSTING BEHAVIOR PADA LAKI-LAKI PENGGUNA MEDIA SOSIAL. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Maghfiroh, Nur (2019) HUBUNGAN ANTARA INTENSITAS KOMUNIKASI DAN KEPERCAYAAN DENGAN KOMITMEN PADA PASANGAN COMMUTER MARRIAGE DI DESA X. Undergraduate thesis, Universitas Islam Sultan Agung.

Maghfiroh, Nur (2020) HUBUNGAN ANTARA INTENSITAS KOMUNIKASI DAN KEPERCAYAAN DENGAN KOMITMEN PADA PASANGAN COMMUTER MARRIAGE DI DESA X. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Magriani, Miranti (2010) HUBUNGAN ANTARA KEPUASAN PERNIKAHAN DAN KECERDASAN EMOSIONAL DENGAN DEPRESI PASCA PERSALINAN PADA WANITAYANGMELAIDRKANANAKPERTAMADIPONDOK RUMAH BERSALIN ALAMANDA UNGARAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Maharani, Adynda Linggar (2019) HUBUNGAN ANTARA REGULASI DIRI DENGAN PERILAKU PROKRASTINASI AKADEMIK PADA MAHASISWA FTI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Maharani, Alvi Yanti (2023) HUBUNGAN ANTARA KONTROL DIRI TERHADAP PEMBELIAN IMPULSIF (IMPULSIVE BUYING) PADA PENGGEMAR K-POP PASCA PANDEMI COVID-19. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Mahdiatunnisa, Sharah (2019) HUBUNGAN ANTARA KEPUASAN KERJA DENGAN KONFLIK PERAN GANDA PADA PERAWAT YANG SUDAH MENIKAH DI RUMAH SAKIT ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Mahendra, Alam Arya (2022) PERSEPSI BRAND MINDED DAN KEPRIBADIAN BIG FIVE DENGAN GAYA HIDUP HEDONIS. Undergraduate thesis, Universitas Islam Sultan Agung.

Mahfiyah, Ainur Rohmatul (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL ORANG TUA TERHADAP KEMANDIRIAN BELAJAR PADA SISWA SMK. Undergraduate thesis, Universitas Islam Sultan Agung.

Mahgfiroh, Siti (2023) HUBUNGAN ANTARA KOMITMEN ORGANISASI DAN ORGANIZATIONAL CITIZENSHIP BEHAVIOR PADA ORGANISASI KARANG TARUNA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Maida, Redina Nuzul (2015) HUBUNGAN ANTARA KONFORMITAS DAN HARGA DIRI DENGAN PERILAKU KONSUMTIF PADA REMAJA PUTRI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Majalisa, Rahmana (2019) KECENDERUNGAN NARSISME PADA PRIA METROSEKSUAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Malia, Rika (2021) HUBUNGAN ANTARA KONTROL DIRI DENGAN PEMBELIAN IMPULSIF PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Maliya, Ikmalu (2021) HUBUNGAN ANTARA POLA ASUH PERMISIF ORANG TUA DENGAN KENAKALAN REMAJA DI DESA REJOSARI KECAMATAN KARANGAWEN KABUPATEN DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Mandar, Amara Difa Nurl Hasanah Jawa (2023) HUBUNGAN ANTARA MANAJEMEN WAKTU DAN DUKUNGAN SOSIAL DENGAN PROKRASTINASI AKADEMIK. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Mansyur, Putri Amalia (2016) HUBUNGAN ANTARA PENERIMAAN DIRI DAN DUKUNGAN SOSIAL TERHADAP KEPUASAN HIDUP PENDERITA PSORIASIS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Maqhfiroh, Yunisa Lailatul (2019) HUBUNGAN ANTARA KEMATANGAN EMOSI DENGAN PENGAMBILAN KEPUTUSAN KARIR PADA SISWA SMA. Undergraduate thesis, Universitas Islam Sultan Agung.

Mardiyanti, Annisa Tri (2017) HUBUNGAN ANTARA KONTROL DIRI DENGAN BURNOUT PADA PEGAWAI BANK JATENG CABANG UNGARAN”. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Mardliana, Alfi (2018) HUBUNGAN ANTARA KOMITMEN ORGANISASI DENGAN INTENSI TURNOVER PADA KARYAWAN PT. ADYAWINSA T&E SEMARANG. Undergraduate thesis, Fakultas Ekonomi UNISSULA.

Marhaen, Monica Alifia (2023) HUBUNGAN ANTARA LINGKUNGAN KERJA DAN STRES KERJA DENGAN KINERJA KARYAWAN. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Marhani, Nina Tri Wira (2021) HUBUNGAN ANTARA DAYA TARIK INTERPERSONAL DENGAN KETERBUKAAN DIRI PADA MAHASISWA TAHUN PERTAMA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Marthana, Nadine Tia Sarani (2021) HUBUNGAN ANTARA GAYA HIDUP DENGAN PERILAKU KONSUMTIF PENGGUNA APLIKASI BELANJA ONLINE PADA MAHASISWI FAKULTAS EKONOMI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Maulana, Alisa (2015) HUBUNGAN ANTARA DUKUNGAN SOSIAL KELUARGA DAN KESEJAHTERAAN PSIKOLOGIS PADA ISTERI YANG MENJALANI LONG DISTANCE RELATIONSHIP DI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Maulida, Fitra Reza (2019) PENERIMAAN DIRI ATAS KONDISI PASANGAN YANG MENDERITA PARKINSON. Undergraduate thesis, Universitas Islam Sultan Agung.

Maulida, Novita (2019) HUBUNGAN ANTARA HARGA DIRI DAN KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU SEKS PRANIKAH PADA REMAJA YANG BERPACARAN DI DESA X KOTA JEPARA. Undergraduate thesis, Universitas Islam Sultan Agung.

Maulida, Novita (2020) HUBUNGAN ANTARA HARGA DIRI DAN KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU SEKS PRANIKAH PADA REMAJA YANG BERPACARAN DI DESA X KOTA JEPARA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Maulidiyah, Gama Septiani (2014) PENGARUH ORIENTASI RELIGIUS TERHADAP RASA BERSYUKUR (GRATITUDE) DENGAN ANCAMAN KEMATIAN SEBAGAI VARIABEL MODERATOR. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Maulina, Deriel Ismarul (2018) HUBUNGAN ANTARA KONSEP DIRI DAN KEPERCAYAAN DIRI DENGAN PERILAKU MEROKOK PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Maziyah, Nur Ilma (2021) HUBUNGAN ANTARA SHIFT KERJA DENGAN STRES KERJA PADA KARYAWAN PT. INDOMARCO PRISMATAMA DISTRIBUTOR CENTER SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Megawati, Megawati (2017) HUBUNGAN ANTARA DUKUNGAN SOSIAL ORANG TUA DAN EFIKASI DIRI PADA MAHASISWA GELAR GANDA DAN MAHASISWA REGULER DI UNISSULA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Megawati, Rahma Ayu (2016) HUBUNGAN ANTARA BERPIKIR POSITIF DENGAN KECEMASAN SOSIAL KETIKA MELAKUKAN PRESENTASI DI DEPAN KELAS PADA MAHASISWA UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Melati, Fatonah Ayudinar (2023) HUBUNGAN ANTARA KECENDERUNGAN BODY DYSMORPHIC DISORDER DENGAN KECEMASAN TIDAK MENGGUNAKAN MAKE-UP PADA MAHASISWI DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Midodes, Aldila (2019) HUBUNGANzANTARAxKECERDASANcEMOSI DENGANvPERILAKU PRO LINGKUNGAN PADA MAHASISWAaFAKULTAScPSIKOLOGIeUNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Miftahuddin, Zaki (2017) `HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DENGAN KENAKALAN REMAJA DESA KEDUNGSARIMULYO KECAMATAN WELAHAN KABUPATEN JEPARA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Millisani, Fitriana (2019) HUBUNGAN ANTARA RASA SYUKUR DAN DUKUNGAN SOSIAL DENGAN KESEJAHTERAAN PSIKOLOGIS PADA GURU HONORER SEKOLAH DASAR DI UPT DISDIKPORA KECAMATAN PAMOTAN KABUPATEN REMBANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Misron, Yusrina Sabrina (2015) HUBUNGAN ANTARA KECERDASAN EMOSI DAN PENYESUAIAN SOSIAL PADA ANAK CERDAS ISTIMEWA DIKELAS AKSELERASI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Mubaraq, Darta Ali (2017) HUBUNGAN ANTARA EFIKASI DIRI DAN ORIENTASI KARIR PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Mufataddiyar, Umarul Masyhuri (2015) MAKNA SEDEKAH BAGI ORANG MISKIN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Mufti, Arsyita Maulida (2021) HUBUNGAN DUKUNGAN SOSIAL KELUARGA DENGAN PSYCHOLOGICAL WELL-BEING PENYINTAS COVID-19 DI KOTA PATI. Undergraduate thesis, Universitas Islam Sultan Agung.

Muftiyani Yustika, Riyana (2023) HUBUNGAN ANTARA KEBERSYUKURAN DENGAN KESEJAHTERAAN SUBJEKTIF PADA PEKERJA SILEM (PENCARI KERANG) DI TAMBAK MULYO SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Muhamad, Fandi (2020) HUBUNGAN ANTARA KONFORMITAS DENGAN AGRESIFITAS PADA SUPPORTER SEPAKBOLA PSIS SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Muhamad, Fendi (2021) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN PERILAKU MEROKOK PADA REMAJA. Undergraduate thesis, Universitas Islam Sultan Agung.

Mulyono, Drajat (2020) HUBUNGAN ANTARA INSENTIF DENGAN MOTIVASI KERJA PADA KARYAWAN PERUSAHAAN X KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Muna, Ni’mal (2021) HUBUNGAN ANTARA POLA ASUH IBU TERHADAP PERILAKU ASERTIF PADA SISWA SMP N 28 KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Munandar, Adamas Sepghatama Aryanda (2023) HUBUNGAN ANTARA PERSEPSI TERHADAP PENERAPAN E-TILANG DENGAN PERILAKU BERKENDARA BERISIKO PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Munasifah, Jazilatul (2017) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN AKTUALISASI DIRI TUNANETRA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Munawar, M. Imam (2017) HUBUNGAN ANTARA KESEJAHTERAAN SUBJEKTIF DENGAN PERILAKU ANTISOSIAL PADA REMAJA DI DESA BABALAN WEDUNG DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Munawar, Muhammad Imam (2020) ISLAMISASI PENCAK SILAT INDONESIA (STUDI KASUS PERSAUDARAAN SETIA HATI TERATE (PSHT) CABANG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Munawaroh, Astuti (2016) HUBUNGAN ANTARA SELF EFFICACY DENGAN KECEMASAN MENYUSUN SKRIPSI PADAMAHASISWA DI FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Munawaroh, Tutiatul (2017) HUBUNGAN ANTARA KONTROL DIRI DENGAN KEPATUHAN BERLALU LINTAS PADA MAHASISWA PENGENDARA SEPEDA MOTOR DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Muniah, Muniah (2014) HUBUNGAN ANTARA PERSEPSI POLA ASUH OTORITER ORANG TUA DENGAN AKTUALISASI DIRI PADA SISWA KELAS XI MAN DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Murti, Marcellino Wahyu Wisnu (2021) HUBUNGAN ANTARA KONTROL DIRI TERHADAP AGRESIVITAS PEMAIN GAME MOBILE LEGENDS PADA KOMUNITAS SEMAR MLBB SEMARANG. Undergraduate thesis, Universitas Sultan Agung.

Musafa’ah, Siti (2023) HUBUNGAN ANTARA EMOSI POSITIF DENGAN PERILAKU PEMBELIAN IMPULSIF PADA MAHASISWI DALAM MELAKUKAN PEMBELIAN DI APLIKASI E-COMMERCE. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Muslim, Hanan (2019) KETAHANAN DIRI (RESILIENSI ) PADA NARAPIDANA PEREMPUAN DENGAN MASA HUKUMAN SEUMUR HIDUP DI LAPAS PEREMPUAN KELAS II A SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Mustagfirin, Muh (2019) HUBUNGAN ANTARA PENERIMAAN DIRI DENGAN PENYESUAIAN DIRI PADA WANITA BERCADAR. Undergraduate thesis, Universitas Islam Sultan Agung.

Mustofa, Muhammad Afif Nawar (2019) HUBUNGAN ANTARA KONTROL DIRI DENGAN PERILAKU KONSUMTIF MEMODIFIKASI MOTOR PADA ANGGOTA CLUB MOTOR DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Muthalib, Muhammad Ferix (2019) HUBUNGAN ANTARA KOMITMEN ORGANISASI DAN BUDAYA ORGANISASI TERHADAP ORGANIZATIONAL CITIZENSHIP BEHAVIOR (OCB) PADA ANGGOTA BADAN EKSEKUTIF MAHASISWA UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Mutiara, Aisah Ranny (2017) HUBUNGAN ANTARA PERSEPSI DUKUNGAN SOSIAL SUAMI DAN OPTIMISME DENGAN PENERIMAAN DIRI PENDERITA LUPUS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Muwahidah, Wardah (2019) KOPING RELIGIUS DENGAN TINGKAT DEPRESI PADA NARAPIDANA DI LAPAS KELAS I KEDUNGPANE SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Muzdalifah, Nur Indah (2003) HUBUNGAN ANT ARA RELIGIUSITAS DENGAN DEPRESI PADA SISW A SMU BATIK 2 SURAKARTA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

N

NADHILAH, NUR DANIA MUHANDISATIN (2020) HUBUNGAN ANTARA KOPING RELIGIUS DENGAN BURNOUT PADA GURU SMK SWASTA DI KECAMATAN X KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

NISA, CHAIRUN (2012) PENGARUH MOTIVASI BELAJAR TERHADAP INTENSITAS PEMANFAATAN PERPUSTAKAAN PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

NUGROHO, AKHMAD SIGIT (2012) HUBUNGAN ANTARA HARGA DIRI DENGAN KECENDERUNGAN DEPRESI PADA REMAJA YANG ORANG TUANYA BERCERAI di KOTA PEKALONGAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

NUNUNG INDRAWATI R., NUNUNG INDRAWATI R. (2004) HUBUNGAN KEPUASAN KERJA DENGAN STRES KERJ PADA KARYAWAN BAGIAN LAPANGAN PERUM PERHUTANI BKPH KEMADOH KPH RANDUBLATUNG BLORA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

NURANI, DITA TRISNA (2021) HUBUNGAN ANTARA STRES AKADEMIK DENGAN ADVERSITY QUOTIENT PADA SISWA SMA DALAM MASA PANDEMI VIRUS COVID-19. Undergraduate thesis, Universitas Islam Sultan Agung.

NURLAZIMAH, SITI (2021) HUBUNGAN ANTARA KONFORMITAS DAN KONTROL DIRI DENGAN KEPATUHAN SANTRI TERHADAP PERATURAN PONDOK DI SMP X MAGELANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nabila, Ivaniar Nadaa (2021) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU PERUNDUNGAN (BULLYING) PADA SANTRIWATI PONDOK PESANTREN AL-ITQON Skripsi Untuk memenuhi persyaratan Memperoleh derajat Sarjana Psikologi. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nabila, Qori (2019) HUBUNGAN ANTARA KONSEP DIRI DAN KONFORMITAS TERHADAP GAYA HIDUP HEDONISME PADA REMAJA DI SMA ISLAM HIDAYATULLAH SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Nabilah, Hanna Amalia Ardi (2022) HUBUNGAN ANTARA RELIGIUSITAS DAN DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN KEBAHAGIAAN PADA ANGGOTA ORGANISASI PERGERAKAN MAHASISWA ISLAM INDONESIA (PMII) KOMISARIAT SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Nadhifah, Lu’lu’ Mafruchatun (2021) HUBUNGAN ANTARA EFIKASI DIRI DAN DUKUNGAN SOSIAL KELUARGA DENGAN STRES PADA IBU RUMAH TANGGA BERPENDIDIKAN TINGGI YANG TIDAK BEKERJA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nadhira, Ajeng Indy (2017) HUBUNGAN ANTARA ADVERSITY QUOTIENT DAN STRES PADA ANGGOTA KEPOLISIAN DI POLRESTABES SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nadifa, Rafila Nuhamida Kusuma (2023) HUBUNGAN ANTARA BEBAN KERJA DENGAN STRES KERJA PADA PERAWAT RSJD DR AMINO GONDOHUTOMO SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Nafiroh, Lailatun (2023) PERAN STIGMA DIRI DAN KEPERCAYAAN KEPADA TENAGA PROFESIONAL TERHADAP SIKAP MENCARI BANTUAN PADA MAHASISWA LAKI-LAKI DEWASA AWAL DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nafi’ah, Inna Rif’atun (2021) HUBUNGAN ETOS KERJA DAN KOMITMEN ORGANISASI DENGAN KINERJA PEGAWAI BALAI PEMASYARAKATAN KELAS 1 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Nantono, Nery Kusuma (2020) HUBUNGAN ANTARA REGULASI DIRI DENGAN PROKRASTINASI PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG (UNISSULA) SEMARANG ANGKATAN 2017. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nashriyati, Rohma Nur (2016) HUBUNGAN ANTARA PEMAAFAN DAN SYUKUR DENGAN KESEJAHTERAAN SPIRITUAL PADA SANTRI REMAJA PONDOK PESANTREN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nasrullah, Khoirul Umami (2014) HUBUNGAN PERSEPSI POLA ASUH DEMOKRATIS DENGAN PERILAKU ASERTIF PADA SISWA MTs MATHALIBUL HUDA JEPARA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nate, Kin Ules (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN MOTIVASI BERPRESTASI PADA SISWA SMA PERGURUAN RAKYAT 2 JAKARTA. Undergraduate thesis, Universitas Islam Sultan Agung.

Nazhifa, Vinsa Dhiathifal (2023) HUBUNGAN ANTARA KONSEP DIRI DENGAN CITRA TUBUH PADA MAHASISWA DI FAKULTAS KEDOKTERAN GIGI UNIVERSITAS X. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Nezarasari, Risma (2020) HUBUNGAN ANTARA DISIPLIN KERJA DAN MOTIVASI KERJA TERHADAP KINERJA KARYAWAN DI PIZZA HUT SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Niawati, Desi (2017) PENGARUH TERAPI KELOMPOK BERBASIS AFIRMASI DIRI UNTUK MENURUNKAN TINGKAT STRES DAN AFEK NEGATIF PADA PASIEN KANKER. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nihayah, Hani’ Darojatin (2014) KEHIDUPAN SOSIAL REMAJA PENDERITA SKIZOFRENIA PASCA HOSPITALISASI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ningrum, Ikke Maulida Fitria (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL ORANGTUA DAN KONFORMITAS DENGAN EFIKASI DIRI PENGAMBILAN KEPUTUSAN KARIR PADA SISWA SMA. Undergraduate thesis, Universitas Islam Sultan Agung.

Ningrum, Retno Fatimatun (2019) KETAKUTAN AKAN KEGAGALAN DITINJAU DARI PERSEPSI TERHADAP HARAPAN ORANG TUA DAN EFIKASI DIRI PADA MAHASISWA YANG MENGERJAKAN SKRIPSI. Undergraduate thesis, Universitas Islam Sultan Agung.

Ningsah, Kiki Rasdian (2017) PERSEPSI TERHADAP PERILAKU TINDAK KRIMINAL DITINJAU DARI KEPRIBADIAN THE BIG FIVE & STATUS HUKUM WANITA NARAPIDANA & WANITA NON NARAPIDANA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ningsih, Dwi Setyo (2020) PERBEDAAN KONTROL DIRI DALAM MEMBELANJAKAN UANG BERDASARKAN ORIENTASI NILAI BUDAYA PADA NELAYAN DESA TASIKAGUNG KECAMATAN REMBANG KABUPATEN REMBANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ningsih, Dwi Setyo (2019) PERBEDAAN KONTROL DIRI DALAM MEMBELANJAKAN UANG BERDASARKAN ORIENTASI NILAI BUDAYA PADA NELAYAN DESA TASIKAGUNG KECAMATAN REMBANG KABUPATEN REMBANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Ningtias, Aulia Prima Ragil (2020) HUBUNGAN KOMUNIKASI INTERPERSONAL DAN BEBAN KERJA DENGAN STRES KERJA PADA PERAWAT RUMAH SAKIT KARDINAH KOTA TEGAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ningtias, Aulia Prima Ragil (2019) HUBUNGAN KOMUNIKASI INTERPERSONAL DAN BEBAN KERJA DENGAN STRES KERJA PADA PERAWAT RUMAH SAKIT KARDINAH KOTA TEGAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Ningtyas, Shinta (2015) HUBUNGAN ANTARA EFIKASI DIRI DAN DORONGAN BERPRESTASI DENGAN PROKRASTINASI AKADEMIK PADA MAHASISWA UNISSULA YANG MEMILIKI PEKERJAAN SAMPINGAN SEBAGAI PELAKU SENI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nirawati, Devita (2021) HUBUNGAN ANTARA KECERDASAN EMOSIONAL DENGAN KUALITAS HUBUNGAN PERSAHABATAN PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nisa, Arina Amna (2023) HUBUNGAN ANTARA KECANDUAN TIKTOK TERHADAP PROKRASTINASI AKADEMIK PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nisa, Fitria Khoirun (2021) HUBUNGAN ANTARA DISTRES PSIKOLOGIS DAN KEMANDIRIAN DENGAN SIKAP TERHADAP PENCARIAN BANTUAN PROFESIONAL PSIKOLOGIS PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nisa, Harisma Fakhrun (2016) KEBERMAKNAAN HIDUP PENDERITA SKIZOFRENIA PASCA RAWAT INAP DI RUMAH SAKIT JIWA KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nishfi, Siti Lailatin (2021) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN PENYESUAIAN DIRI REMAJA DI SMA PONDOK MODERN SELAMAT 2 BATANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Ni’mah, Ulfiyatun (2017) HUBUNGAN ANTARA KEPERCAYAAN DIRI DAN POLA ASUH OTORITATIF DENGAN CITRA DIRI PADA MAHASISWI FAKULTAS PSIKOLOGI UNISSULA YANG MELAKUKAN PERAWATAN WAJAH DI KLINIK KECANTIKAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nofiyana, Kurnia (2019) PENERIMAAN DIRI PADA WANITA DENGAN GANGGUAN BIPOLAR. Undergraduate thesis, Universitas Islam Sultan Agung.

Noor, Fina Isnadia (2017) HUBUNGAN ANTARA STRES DAN KESEPIAN DENGAN KECANDUAN MEDIA SOSIAL PADA SISWA SMA N 1 KENDAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Noor, Intan Zulfiana (2014) HUBUNGAN ANTARA KECERDASAN EMOSIONAL DENGAN KUALITAS PERSAHABATAN PADA REMAJA AKHIR FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Noor, Jauharina Zahrotun (2023) KOMITMEN AKAN PERNIKAHAN PADA WANITA LAJANG USIA DIATAS TIGA PULUH TAHUN : FENOMENA MELAJANG PADA WANITA KARIR. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Nordiansyah, Agus (2021) HUBUNGAN ANTARA SELF COMPASSION DENGAN STRES PENGASUHAN PADA IBU YANG MEMILIKI ANAK RETARDASI MENTAL DI SLB NEGERI YOGYAKARTA. Undergraduate thesis, Universitas Islam Sultan Agung.

Novalia, Ganevie (2017) PERBEDAAN SUBJECTIVE WELL-BEING PADA IBU BEKERJA DENGAN IBU YANG TIDAK BEKERJA YANG BERTEMPAT TINGGAL DI WILAYAH KELURAHAN PANDEAN LAMPER KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Novelaisra, Stefani (2021) HUBUNGAN ANTARA MOTIVASI KERJA DAN LINGKUNGAN KERJA TERHADAP KINERJA KARYAWAN PT PERKEBUNAN NUSANTARA IX KEBUN SEMUGIH. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Noviani, Farah Diba (2019) HUBUNGAN ANTARA EFIKASI DIRI DAN DUKUNGAN SOSIAL ORANG TUA DENGAN PENGAMBILAN KEPUTUSAN KARIR PADA SISWA SMA. Undergraduate thesis, Universitas Islam Sultan Agung.

Noviati, Noviati (2023) SCHOOL WELL BEING DITINJAU DARI PEER ATTACHMENT PADA SANTRIWATI SMP AL-QUR’AN TERPADU AL-HAMIDIYAH, BULUMANIS KIDUL, PATI. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Novita, Septyana Ayu (2021) HUBUNGAN ANTARA KECERDASAN EMOSIONAL DENGAN KECENDERUNGAN ALEXITHYMIA PADA REMAJA YANG TINGGAL DI PANTI ASUHAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Novitasari, Meisy (2022) HUBUNGAN ANTARA PROBLEM FOCUSED COPING DENGAN STRES AKADEMIK PADA MAHASISWA YANG MENYUSUN SKRIPSI DI FAKULTAS DAKWAH DAN KOMUNIKASI UIN WALISONGO SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Nugraha, Dwi Septiani (2017) HUBUNGAN ANTARA KECERDASAN SPIRITUAL DAN KECERDASAN EMOSIONAL DENGAN PERILAKU PROSOSIAL PADA REMAJA YANG TINGGAL DI PANTI ASUHAN X SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nugraha, Muhammad Hilmi (2022) HUBUNGAN ANTARA KONFORMITAS DENGAN PERILAKU DUGEM PADA MAHASISWA DI CIREBON SELAMA PANDEMI COVID 19. Undergraduate thesis, Universitas Islam Sultan Agung.

Nugraheni, Uliya (2022) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DAN DUKUNGAN SOSIAL ORANG TUA DENGAN PENGAMBILAN KEPUTUSAN KARIR PADA SISWA KELAS XII SMA NEGERI 1 COMAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nugraheny, Bintari Mahar (2016) HUBUNGAN ANTARA MOTIF BERMAIN DENGAN KECANDUAN GAME POKEMON GO PADA REMAJA DI KOMUNITAS GAMER YOGYAKARTA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nur, Rahmad (2017) HUBUNGAN ANTARA KECEMASAN SOSIAL DENGAN KECENDERUNGAN DEPRESI PADA REMAJA DI SMA X. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nur Aini, Farida (2022) HUBUNGAN ANTARA POLA ASUH OTORITER DENGAN KECERDASAN EMOSI PADA SISWA MA RIYADLOTUT THALABAH SEDAN REMBANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nur Febriansyah, Rosalian (2022) HUBUNGAN ANTARA INTENSITAS MENGIKUTI PENGAJIAN DENGAN KESEJAHTERAAN PSIKOLOGIS IBU-IBU PKK DESA WINONG PATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nurakifa, Nurakifa (2017) SUBJECTIVE WELL BEING PADA REMAJA AKHIR PENYANDANG TUNA DAKSA DITINJAU DARI OPTIMISME DAN KEPRIBADIAN EKSTROVERT. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nuralifah, Irma Putri (2014) HUBUNGAN ANTARA EMPATI DAN DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN PERILAKU PROSOSIAL PADA REMAJA DI SMP ISLAM PLUS AS-SALAMAH UNGARAN KABUPATEN SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nurayni, Nurayni (2017) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN RASA MEMILIKI TERHADAP KESEPIAN PADA MAHASISWA PERANTAU SEMESTER AWAL DI UNIVERSITAS DIPONEGORO. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nurbaeti, Rizky (2017) HUBUNGAN ANTARA PERSEPSI TERHADAP FENOMENA SELEBRITI INSTAGRAM DENGAN ORIENTASI MASA DEPAN HUBUNGAN ROMANTIS PADA REMAJA AKHIR. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nurbaiti, Ayu Maulida (2018) HUBUNGAN ANTARA MONITORING DIRI DENGAN KEPUASAN PERNIKAHAN PADA PASANGAN DI PANTI SOSIAL PROVINSI JAWA TENGAH. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nurdianti, Ryzka (2017) HUBUNGAN ANTARA POLA ASUH DEMOKRATIS DAN KEPERCAYAAN DIRI TERHADAP PERLINDUNGAN DIRI PADA ANAK YANG BERPOTENSI MENJADI KORBAN PELECEHAN SEKSUAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nurfadillah, Siti (2014) HUBUNGAN ANTARA OPTIMISME DENGAN KESEJAHTERAAN PSIKOLOGIS PADA REMAJA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nurfaizah, Siti (2023) HUBUNGAN ANTARA LINGKUNGAN KERJA, STRES KERJA, BEBAN KERJA TERHADAP TURNOVER INTENTION PADA KARYAWAN PREMIUM PLUS LAUNDRY PEDURUNGAN SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Nurhayati, Dian Putri (2021) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DENGAN PENGAMBILAN KEPUTUSAN KARIR PADA SISWA SMA NEGERI 2 KENDAL. Undergraduate thesis, Universitas Sultan Agung.

Nurhayati, Nurhayati (2016) HUBUNGAN ANTARA KESEPIAN DAN KECEMASAN SOSIAL DENGAN KECANDUAN INTERNET PADA REMAJA SMA ISLAM SULTAN AGUNG 3 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nurlitasari, Dita (2017) HUBUNGAN ANTARA KEMATANGAN EMOSI DENGAN RASA EMPATI PADA MAHASISWI PENDAKI GUNUNG DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nurpratiwi, Diana Hafsari (2017) HUBUNGAN PERSEPSI KEADILAN DISTRIBUTIF DAN KEADILAN PROSEDURAL DENGAN TINGKAT KEPERCAYAAN MASYARAKAT PADA POLISI REPUBLIK INDONESIA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nurrokhmah, Ayu Rezki (2021) HUBUNGAN ANTARA KECERDASAN SPIRITUAL DENGAN ADAPTABILITAS KARIR PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nurthiani, Iga Mangesthi Suluhing (2020) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KESIAPAN KERJA PADA MAHASISWA FAKULTAS HUKUM UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Nuruzzaman, Ahmad Maulana (2015) HUBUNGAN ANTARA KONFORMITAS KELOMPOK DENGAN KENAKALAN REMAJA PADA SANTRI DI PONDOK PESANTREN X DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Nuzulawati, Meti Try Nur (2015) HUBUNGAN ANTARA KEPRIBADIAN TIPE A DENGAN STRES KERJA PADA GURU SMK MUHAMMADIYAH KOTA TEGAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

nurnija, nurnija (2018) Peran Kematangan Emosi dan Dukungan Sosial Orang tua terhadap Penyesuaian Akademik pada Mahasiswa Universitas Islam Sultan Agung Semarang. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

O

OCTAVIANI, ERNI DWI (2011) HUBUNGAN ANTARA RELIGIUSITAS DENGAN KEDISIPLINAN PADA ANGGOTA POLRI DI POLRES KENDAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Octaviana, Arinda Purnama (2021) HUBUNGAN ANTARA DUKUNGAN SOSIAL SUAMI DENGAN KONFLIK PERAN GANDA PADA GURU WANITA YANG SUDAH MENIKAH DI KABUPATEN KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Octaviani, Friesca Ayudya (2020) HUBUNGAN ANTARA RELIGIUSITAS DAN PERILAKU SEKS PRANIKAH PADA MAHASISWA UNIVERSITAS X YANG BERPACARAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Octaviani, Friesca Ayudya (2019) HUBUNGAN ANTARA RELIGIUSITAS DAN PERILAKU SEKS PRANIKAH PADA MAHASISWA UNIVERSITAS X YANG BERPACARAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Oktafiyani, Eka (2015) RESILIENSI PADA ISTRI YANG MEMILIKI SUAMI TERPIDANA TERORIS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Oktaviani, Putri (2019) HUBUNGAN ANTARA KOMITMEN DAN KEMATANGAN EMOSI DENGAN KEPUASAN PERNIKAHAN PADA SUAMI YANG MEMILIKI ISTRI BERKARIR. Undergraduate thesis, Universitas Islam Sultan Agung.

Oktaviani, Putri (2020) HUBUNGAN ANTARA KOMITMEN DAN KEMATANGAN EMOSI DENGAN KEPUASAN PERNIKAHAN PADA SUAMI YANG MEMILIKI ISTRI BERKARIR. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Oktaviani, Wulan (2017) RELASI TEMAN SEBAYA DAN DUKUNGAN SOSIAL ORANG TUA SEBAGAI PREDIKTOR PRESTASI BELAJAR SISWA SMP ISLAM SULTAN AGUNG 4 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Oktriansyah, Ryan (2019) HUBUNGAN ANTARA KONFLIK PERAN GANDA DENGAN STRES KERJA PADA PEREMPUAN YANG BEKERJA DI LEMBAGA PEMASYARAKATAN. Undergraduate thesis, Universitas Islam Sultan Agung.

P

PARINDRATI, SEKAR RAHAS (2012) HUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEPROFESI DENGAN HARGA DIRI PADA PETUGAS KEBERSIHAN UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

PUJASARI, KARINA DWI (2019) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU PERUNDUNGAN PADA SISWA SMA ISLAM SULTAN AGUNG 3 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

PUJIASTUTI, NAYOSI VINY BUANA (2021) HUBUNGAN ANTARA KONFORMITAS DENGAN PERILAKU AGRESIF PEMAIN GAME ONLINE PADA KOMUNITAS MLBB POLINES ESPORT. Undergraduate thesis, Universitas Islam Sultan Agung.

PUTRA, ANDANG PURBAYA SUYITNO (2008) MINAT TERHADAP MEDIA PORNOGRAFI DITINJAU DARI RELIGIUSITAS PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS X SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

PUTRA, BIONDI DESTRIATMA (2023) HUBUNGAN ANTARA FORGIVENESS DENGAN WOUNDED INNER CHILD PADA REMAJA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Pahlevi, Adhe Riza (2016) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KECURANGAN AKADEMIK PADA MAHASISWA PSIKOLOGI UNIVERSITAS X. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Pamungkas, Fajar Gumelar Putra (2021) HUBUNGAN ANTARA ETOS KERJA DENGAN PRODUKTIVITAS KERJA PADA PEGAWAI DINAS DUKCAPIL KABUPATEN KUDUS. Undergraduate thesis, Universitas Islam Sultan Agung.

Pamungkas, Puput Nirmawati (2016) HUBUNGAN ANTARA RELIGIUSITAS DAN PEMAAFAN PADA WANITA MENIKAH DI RUSUNAWA KALIGAWE SEMARANG, JAWA TENGAH. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Pangesti, Aulia Endini Dewi (2023) PERAN PEMBELAJARAN BERDASAR REGULASI DIRI TERHADAP PROKRASTINASI AKADEMIK PADA MAHASISWA TINGKAT AKHIR. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Pangestu, Vera Sissilia (2016) RESILIENSI SINGLE MOTHER PASCA PERCERAIAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Paramita, Dita (2016) PERBEDAAN KEBERMAKNAAN HIDUP LANSIA DI PANTI WREDHA DAN DI RUMAH DI KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Parwati, Yuyun (2017) HUBUNGAN ANTARA KONFORMITASDENGAN GAYA HIDUP HEDONIS PADA MAHASISWA KEDOKTERAN UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Pati, Wisnu Catur Bayu (2015) HUBUNGAN ANTARA KONTROL DIRI DENGAN PERILAKU PRO LINGKUNGAN PADA MAHASISWA DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Patrianingsih, Mery (2012) HUBUNGAN ANTARA OPTIMISME DAN NILAI PRESTASI DENGAN PERILAKU MENCONTEK PADA SISWA SMA ISLAM SULTAN AGUNG 3 SEMARANG DAN SISWA SMP ISLAM SULTAN AGUNG 4 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Perakin, Roosyiduana (2017) HUBUNGAN ANTARA DUKUNGAN SOSIAL KELUARGA DENGAN PENERIMAAN ORANG TUA YANG MEMILIKI ANAK PENYANDANG AUTIS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Permatasari, Dessy (2016) HUBUNGAN ANTARA MOTIVASI BERPRESTASI DAN PENYESUAIAN DIRI TERHADAP PRESTASI BELAJAR MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Permatasari, Erina (2017) PERAN DAN TANGGUNG JAWAB NOTARIS TERHADAP PELAKSANAAN PENDAFTARAN BADAN HUKUM PERSEROAN TERBATAS MELALUI SISTEM ONLINE. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Pitalokha, Dina (2023) HUBUNGAN ANTARA BODY SHAMING DENGAN KEPERCAYAAN DIRI PADA REMAJA PUTRI DI SMAN 1 BATANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Prabasiwi, Niken Asri (2016) DAMPAK PSIKOLOGIS MEMBACA FANFICTION TERHADAP PERSPEKTIF TERHADAP LGBT PADA PENGGEMAR KISAH ROMAN GAY JEPANG & KOREA (FUJOSHI). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Prabhawa, Aditya (2014) KECENDERUNGAN BUNUH DIRI PADA ISTRI, KORBAN KDRT DI KABUPATEN SEMARANG (Studi Kasus kekerasan Terhadap Istri). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Prabowo, Kenang Gilang (2021) HUBUNGAN ANTARA DUKUNGAN SOSIAL ORANGTUA DENGAN PENGAMBILAN KEPUTUSANAN KARIR SISWA DI SMA 10 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Pradevi, Aulia Anggaini (2017) HUBUNGAN ANTARA KECENDERUNGAN NARSISTIK DAN MACHIAVELLIANISME DENGAN AGRESIVITAS DI MEDIA SOSIAL OLEH REMAJA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Pradipa, Choirul Huda (2023) INTERVENSI MUROTTAL AL-QURAN UNTUK MENINGKATKAN KESEJAHTERAAN PSIKOLOGI PADA TAHANAN DAN NARAPIDANA WANITA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Pradipta, Alviora Elga (2019) HUBUNGAN ANTARA POLA ASUH PERMISIF ORANG TUA DENGAN KEDISIPLINAN PADA SISWA SMA N 3 TEMANGGUNG. Undergraduate thesis, Universitas Islam Sultan Agung.

Pradipta, Rizky Tito (2019) HUBUNGAN KOMPENSASI DAN LINGKUNGAN KERJA DENGAN KEPUASAN KERJA KARYAWAN PT. SARANA MULTI SELULER CABANG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Prakoso, Fajar Adi (2018) HUBUNGAN ANTARA KEPUASAN KERJA DENGAN KESEJAHTERAAN SUBJEKTIF PADA KARYAWAN PERUSAHAAN X KABUPATEN SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Pramesti, Nadya Octa (2021) HUBUNGAN ANTARA PENERIMAAN DIRI DENGAN KEBERMAKNAAN HIDUP PADA NARAPIDANA DI LEMBAGA PEMASYARAKATAN KELAS I SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Pranata, Ekto Dea (2020) HUBUNGAN ANTARA KECANDUAN GAME ONLINE DENGAN PENYESUAIAN SOSIAL PADA REMAJA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Prasetya, Deri Iman (2023) FAKTOR-FAKTOR PENDORONG DAN RISK TAKING BEHAVIOR PADA MAHASISWA NASABAH PINJAMAN ONLINE (pinjol) DI UNISSULA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Prasetyaningtyas, Laely Dea Widiastuti (2020) HUBUNGAN ANTARA KEBAHAGIAAN DAN DUKUNGAN SOSIAL TERHADAP KUALITAS HIDUP KARYAWAN AGEN PT TLKM. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Prasetyo, Dhani (2016) PENYESUAIAN DIRI REMAJA LESBIAN DI KOTA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Prasetyo, Dony Dwi (2021) HUBUNGAN ANTARA KEMATANGAN EMOSI DENGAN PERILAKU PERUNDUNGAN SIBER (CYBERBULLYING) PADA SISWA SEKOLAH MENENGAH KEJURUAN PENGGUNA MEDIA SOSIAL DI SMK ISLAMIYAH ADIWERNA. Undergraduate thesis, Universitas Islam Sultan Agung.

Prasetyo Wijanarko, Andhika (2023) HUBUNGAN ANTARA DUKUNGAN SOSIAL KELUARGA DENGAN KESEJAHTERAAN PSIKOLOGIS PADA MAHASISWA TAHUN PERTAMA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Prastika, Fara Okta (2022) HUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN STRESS AKADEMIK DALAM PENYUSUNAN SKRIPSI PADA MAHASISWA FAKULTAS TEKNIK DI UNIVERSITAS SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Prastowo, Devi Ulfiana (2019) HUBUNGAN ANTARA HARGA DIRI DENGAN SELF PRESENTATION PENGGUNA MEDIA SOSIAL PADA REMAJA PUTRI SMA ISLAM SULTAN AGUNG 1 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Prastowo, Devi Ulfiana (2020) HUBUNGAN ANTARA HARGA DIRI DENGAN SELF PRESENTATION PENGGUNA MEDIA SOSIAL PADA REMAJA PUTRI SMA ISLAM SULTAN AGUNG 1 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Prastya, Andhika Bagus (2023) HUBUNGAN ANTARA MEMAAFKAN DENGAN KESEJAHTERAAN PSIKOLOGIS ORANG DENGAN HIV / AIDS (ODHA) DI KENDAL. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Pratama, Herid Syukran (2019) HUBUNGAN ANTARA RELIGIUSITAS DENGAN KENAKALAN REMAJA DI SMA X SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Pratama, Mohamad Rifky Anugrah (2019) HUBUNGAN ANTARA KONSEP DIRI DAN PUSAT KENDALI (LOCUS OF CONTROL) TERHADAP KEMATANGAN KARIR SISWA DI SMK NEGERI 1 SINDANG INDRAMAYU. Undergraduate thesis, Universitas Islam Sultan Agung.

Pratama, Mohamad Rifky Anugrah (2020) HUBUNGAN ANTARA KONSEP DIRI DAN PUSAT KENDALI (LOCUS OF CONTROL) TERHADAP KEMATANGAN KARIR SISWA DI SMK NEGERI 1 SINDANG INDRAMAYU. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Pratama, Muhammad Ridwan Aziz (2016) HUBUNGAN ANTARA INDECISIVE TERHADAP POLITIK DENGAN PARTISIPASI POLITIK MAHASISWA PEMILIH PEMULA PADA PEMILIHAN PRESIDEN REPUBLIK INDONESIA 2014. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Pratama, Tamara Sindy (2021) HUBUNGAN ANTARA EFIKASI DIRI DAN REGULASI EMOSI DENGAN STRES AKADEMIK MAHASISWA FAKULTAS KEDOKTERAN UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Pratama, Veais Nindika (2021) HUBUNGAN ANTARA KUALITAS HIDUP DENGAN KRISIS SEPEREMPAT HIDUP PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Pratama, Yudha Anityo (2017) HUBUNGAN PROBLEM FOCUSED COPING DAN OPTIMISME DENGAN STRES PADA MAHASISWI AKTIVIS ORGANISASI INTRA KAMPUS DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Pratiwi, Berkah Mei (2017) HUBUNGAN ANTARA KARAKTERISTIK KEPRIBADIAN THE BIG FIVE DENGAN SIKAP BUNUH DIRI PADA WANITA DARI KELUARGA MISKIN DI DESA CEBOLEK PATI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Pratiwi, Dheanita Setyanti (2021) HUBUNGAN ANTARA MOTIVASI BERPRESTASI DENGAN KEBERMAKNAAN HIDUP PADA ATLET BELADIRI TARUNG DERAJAT YANG PERNAH MENGALAMI KEKALAHAN BERTANDING. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Pratiwi, Dian Suci (2019) HUBUNGAN ANTARA RELIGIUSITAS DAN HARGA DIRI DENGAN PERILAKU SEKS PRANIKAH DI SMA X DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

Pratiwi, Irma Cindra (2021) HUBUNGAN ANTARA POLA ASUH OTORITER ORANG TUA DENGAN PENGAMBILAN KEPUTUSAN KARIR PADA SISWA SMA NEGERI 9 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Pratiwi, Isabina Niken (2023) HUBUNGAN ANTARA INDONESIAN VALUE DENGAN REGULASI EMOSI PADA ANGGOTA ANXIETYCARE JATENG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Pratiwi, Maulida Edlin (2019) INTERVENSI KEBERSYUKURAN TERHADAP SUBJECTIVE WELL-BEING WARGA BINAAN PEMASYARAKATAN PEREMPUAN DI LEMBAGA PEMASYARAKATAN “X”. Undergraduate thesis, Universitas Islam Sultan Agung.

Pratiwi, Reva Adelia (2023) HUBUNGAN ANTARA KONFLIK PERAN GANDA (WORK FAMILY CONFLICT) DENGAN KEPUASAN PERNIKAHAN PADA ISTRI YANG MENJALANI PERNIKAHAN JARAK JAUH. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Pratiwi, Vidya Restu (2016) HUBUNGAN ANTARASELF-EFFICACY DENGAN JOB INSECURITY PADA KARYAWAN OUTSOURCINGPT. X SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Prawestri, Aizhe (2018) HUBUNGAN ANTARA HARGA DIRI DAN KONFORMITAS DENGAN PEMBELIAN KOMPULSIF PADA MAHASISWA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Priaji, Khaviv (2021) HUBUNGAN BEBAN KERJA DENGAN STRES KERJA PEGAWAI PT. BANDHA GHARA REKSA DIVRE SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Priambodo, Dicky Agung (2015) HUBUNGAN ANTARA EXTERNAL LOCUS OF CONTROL DENGAN PROKRASTINASI AKADEMIK MAHASISWA AKTIVIS UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Prihasaha, Dhea Andarashanti (2022) HUBUNGAN ANTARA MOTIVASI KERJA DENGAN KINERJA ANGGOTA KEPOLISIAN DI POLRES REMBANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Prikurnia, Arthur Erwin (2019) HUBUNGAN ANTARA MOTIVASI DENGAN KINERJA MAHASISWA PADA ORGANISASI MAHASISWA DAERAH FORUM KOMUNIKASI MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung.

Priwidianti, Ayu Saras (2019) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU AGRESIF PADA SISWA DI SMK NEGERI 10 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Puasanti, Sentika (2019) HUBUNGAN ANTARA INTENSITAS PENGGUNAAN GADGET DENGAN MOTIVASI BELAJAR SISWA SMK TUNAS HARAPAN PATI. Undergraduate thesis, Universitas Islam Sultan Agung.

Puguh Waskitha, Dewandha (2023) HUBUNGAN ANTARA KEPERCAYAAN KONSUMEN DENGAN MINAT BELANJA ONLINE PADA SISWA SMA N 1 SAMBUNGMACAN SRAGEN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Pujangga, Jilma Sang (2015) EFEKTIVITAS FILM “KITA VS KORUPSI” DALAM MERUBAH SIKAP TERHADAP KORUPSI PADA SISWA SMA NEGERI 6 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Pungki, Diana (2016) ANALISIS PROSEDUR PEMBERIAN KREDIT USAHA RAKYAT (KUR) MIKRO TERHADAP USAHA MIKRO DAN KECIL (UMK) PADA PT BANK RAKYAT INDONESIA (PERSERO) UNIT KLUWUT CABANG BREBES. Diploma thesis, Fakultas Psikologi UNISSULA.

Purnama, Aelicia Goldy (2022) INTENSITAS PENGGUNAAN MEDIA SOSIAL DAN KESEPIAN TERHADAP NOMOPHOBIA PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung.

Purwanda, Oktario Bagus (2015) KEBERMAKNAAN HIDUP PADA REMAJA YANG MENGALAMI PUTUS SEKOLAH. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Purwaningsih, Dewi (2018) HUBUNGAN ANTARA PERSEPSI TERHADAP CELEBRITY ENDORSER FASHION DAN MOTIVASI MEMBELI DENGAN KEPUTUSAN PEMBELIAN PRODUK ONLINE SHOP PADA MAHASISWI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Puspaningrum, Aulia Feby (2020) HUBUNGAN ANTARA KONFORMITAS DENGAN PENGAMBILAN KEPUTUSAN DALAM MENGGUNAKAN PRODUK MAKE UP PADA REMAJA PUTRI DI SMA “X” KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Puspita Sari, Indah (2022) HUBUNGAN ANTARA EFIKASI DIRI DAN DUKUNGAN SOSIAL KELUARGA DENGAN KECEMASAN MENYUSUN SKRIPSI PADA MAHASISWA FAKULTAS TEKNIK DAN INFORMATIKA UNIVERSITAS PGRI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Puspitahati, Claudia Maharani (2021) HUBUNGAN ANTARA MEMAAFKAN DAN DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN KEBAHAGIAAN PADA WANITA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Puspitaninrum, Shinta (2019) HUBUNGAN ANTARA BEBAN KERJA DENGAN STRES KERJA PADA ANGGOTA POLISI DI POLRESTABES SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Puspitasari, Dhita Ayu (2021) HUBUNGAN ANTARA PERSEPSI GAYA KEPEMIMPINAN TRANSFORMASIONAL DENGAN STRES KERJA PADA POLISI DI POLRES TEGAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Putra, Akbar Razaq (2022) HUBUNGAN ANTARA MOTIVASI KERJA DENGAN KINERJA KARYAWAN DINAS SOSIAL PROVINSI JAWA TENGAH. Undergraduate thesis, Universitas Islam Sultan Agung.

Putra, Muhammad Maulana Ananda (2022) HUBUNGAN EFIKASI DIRI DAN STRATEGI KOPING PADA KARYAWAN USIA DEWASA AWAL YANG MENGALAMI PHK SELAMA PANDEMI COVID – 19 DI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Putri, Adhiene Damayanti (2023) PENGARUH SIKAP MALAS BELAJAR DAN PLEASURE SEEKING TERHADAP PROKRASTINASI AKADEMIK PADA MAHASISWA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Putri, Alina Regita (2021) HUBUNGAN ANTARA KOMUNIKASI INTERPERSONAL ORANG TUA DENGAN AGRESIVITAS GENERASI Z DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Putri, Anastasya Cintya (2017) KONFLIK INTRAPERSONAL EKSEKUTOR HUKUMAN MATI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Putri, Artika Rosita (2019) HUBUNGAN ANTARA KOMUNIKASI POSITIF DALAM KELUARGA DAN KEPERCAYAAN DIRI DENGAN PERILAKU ASERTIF PADA SISWA SMA NEGERI 10 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Putri, Atika Gilang Rahayu (2019) HUBUNGAN ANTARA EMPATI TERHADAP PERILAKU PROSOSIAL PADA SISWA SMK N 10 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Putri, Citra Melati (2012) HUBUNGAN ANTARA KEMATANGAN EMOSI DENGAN PERILAKU AGRESI PADA SISWA SMK DINAMIKA KOTA TEGAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Putri, Ega Rengganis (2016) PERILAKU BERBELANJA SECARA ONLINE DITINJAU DARI GAYA HIDUP HEDONIS PADA MAHASISWI FAKULTAS PSIKOLOGI ANGKATAN 2013 UNIVERSITAS ISLAM SULTAN AGUNG KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Putri, Fairuz Zulfa Aleokta (2023) KECEMASAN BERBICARA BAHASA INGGRIS PADA USER LEVEL BEGINNER KOMUNITAS SPEAKING ENGLISH ONLINE (CHITCHAT) DITINJAU DARI SELF EFFICACY. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Putri, Fanda Virginia Citra (2021) HUBUNGAN ANTARA OPTIMISME MASA DEPAN DAN KEPRIBADIAN HARDINESS TERHADAP ADAPTABILITAS KARIR MAHASISWA PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Putri, Intan Silvia (2017) HUBUNGAN ANTARA KEMATANGAN EMOSI DENGAN PENYESUAIAN DIRI SANTRI DI PONDOK PESANTREN AL-MA’RUF MRANGGEN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Putri, Intan Surya (2020) HUBUNGAN ANTARA EFIKASI DIRI DAN INTERNAL LOCUS OF CONTROL TERHADAP KEMATANGAN KARIR SISWA DI SMK SETIABUDHI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Putri, Irina Juliana (2019) HUBUNGAN ANTARA PEMAAFAN DAN RELIGIUSITAS TERHADAP KEBAHAGIAAN NARAPIDANA DI LAPAS WANITA KELAS II A KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Putri, Maharani Sukarno (2016) HUBUNGAN ANTARA SIKAP TERHADAP KEPEMIMPINAN ATASAN DENGAN ORGANIZATIONAL CITIZENSHIP BEHAVIOR (OCB) PADA KARYAWAN HOTEL X SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Putri, Nabilah Purnama (2023) HUBUNGAN ANTARA HARGA DIRI DENGAN OPTIMISME MASA DEPAN PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Putri, PutriRahaningtyas Wira Kencana (2021) HUBUNGAN ANTARA MANAJEMEN WAKTU DAN MOTIVASI BELAJAR DENGAN PRESTASI AKADEMIK MAHASISWA AKTIF PADUAN SUARA FIRDAUS CHOIR UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Putri, Reneta Utami (2019) HUBUNGAN ANTARA EFIKASI DIRI DENGAN STRES KERJA PADA GURU SLB WIDYA BAKTI DAN YPAC DI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Putri, Reneta Utami (2020) HUBUNGAN ANTARA EFIKASI DIRI DENGAN STRES KERJA PADA GURU SLB WIDYA BAKTI DAN YPAC DI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Putri, Rezania Nurul Hidaya Surdiana (2011) HUBUNGAN ANTARA PERSEPSI TERHADAP DUKUNGAN SOSIAL KELOMPOK DENGAN PROBLEM FOCUSED COPING PADA ISTRI YANG MENGALAMI KEKERASAN DALAM RUMAH TANGGA (KDRT) DI LRC-KJHAM SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Putri, Rizqi Ananda (2021) PERAN KONFORMITAS TEMAN SEBAYA DAN KENYAMANAN PELAYANAN TERHADAP PERILAKU KONSUMTIF MELALUI SHOPEE PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Putri, Rokhania (2022) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN BODY SHAME PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Putri, Siti Firdha Ina (2021) HUBUNGAN HARDINESS DAN KONSEP DIRI DENGAN KECEMASAN KARIR PADA MAHASISWA ANGKATAN 2017 YANG SEDANG MENJALANI SKRIPSI DI FAKULTAS FKIP DAN FBIK UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Putri, Sthefanie Adinda Farra Aini (2014) HUBUNGAN ANTARA REGULASI EMOSI DENGAN KECENDERUNGAN PERILAKU DELINKUENSI PADA REMAJA DI SMK SEPULUH NOPEMBER SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Putri, Syahida Alwin Widya (2017) HUBUNGAN ANTARA KEPERCAYAAN DIRI DAN REGULASI EMOSI TERHADAP KECEMASAN MENGHADAPI PERTANDINGAN PADA ATLET KARATE DI KOTA DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Putri, Tika Imaniar Firani (2021) HUBUNGAN ANTARA KECANDUAN SMARTPHONE DAN REGULASI DIRI DENGAN PROKRASTINASI AKADEMIK PADA SISWA SMAN 04 OKU DALAM SISTEM SCHOOL FROM HOME. Undergraduate thesis, Universitas Islam Sultan Agung.

Putti, Febtina Hendiannisa (2022) HUBUNGAN ANTARA KELEKATAN ORANG TUA DENGAN STRES AKADEMIK PADA MAHASISWA YANG MENYUSUN TUGAS AKHIR DI FAKULTAS TEKNIK UNIVERSITAS DIPONEGORO. Undergraduate thesis, Universitas Islam Sultan Agung.

Q

QUEENA, AYURESTHA YUNFRIDZA K (2022) HUBUNGAN ANTARA KESEJAHTERAAN DENGAN MOTIVASI KERJA PADA KARYAWAN YANG BEKERJA DI BIDANG KULINER DI KECAMATAN GUNUNGPATI, KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Qolbi, Aldya Putri (2023) HUBUNGAN ANTARA RELIGIUSITAS DENGAN SEKSISME AMBIVALEN PADA MAHASISWA LAKI-LAKI DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Qotrunnada, Berliana Marshiela (2023) HUBUNGAN PERSEPSI TERHADAP CELEBRITY ENDORSER DENGAN KEPUTUSAN PEMBELIAN PRODUK KOLABORASI OREO BLACKPINK PADA REMAJA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Qudsiyah, Imamatul (2019) HUBUNGAN ANTARA KONSEP DIRI DENGAN KECENDERUNGAN CINDERELLA COMPLEX PADA MAHASISWI KEPERAWATAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Qurrotul ‘Aini, Putri (2022) HUBUNGAN ANTARA KONTROL DIRI DENGAN CELEBRITY WORSHIP PADA FANDOM ARMY KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

R

RACHMAYANI, ANDIEN (2011) KECEMASAN DALAM MENGHADAPI PERSALINAN DITINJAU DARI DUKUNGAN SOSIAL SUAMI PADA IBU HAMIL YANG BEKERJA DAN YANG TIDAK BEKERJA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

RAFIDAYANTI, NABILLA (2022) PSYCHOLOGYCAL WELL-BEING PADA SUAMI ISTRI YANG BELUM MEMILIKI KETURUNAN. Undergraduate thesis, Universitas Islam Sultan Agung.

RIANTRISTYADI, MUHAMAD AKHSAN (2019) HUBUNGAN ANTARA RELIGIUSITAS DAN OPTIMISME DENGAN KESEJAHTERAAN PSIKOLOGIS PADA SISWI MA 2 FUTUHIYYAH DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

RIDESTA, MALVIN ABI (2020) DEINDIVIDUASI DENGAN PERILAKU UJARAN KEBENCIAN DITINJAU DARI GENDER PADA MAHASISWA PENGGUNA INSTAGRAM FAKULTAS HUKUM UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

RIFQI, MUHAMMAD (2018) Hubungan Persepsi Kualitas Pelayanan Kesehatan dengan Kepuasan Pasien Badan Penyelenggaraan Jaminan Sosial (BPJS) Di Rumah Sakit Islam Swasta. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

RINDANG ANDADARI, HARDIKA (2023) DUKUNGAN SOSIAL DAN KEBAHAGIAAN PADA MAHASISWA KOMUNITAS BERBAGI NASI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

RISNIA, DITA (2019) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN KECEMASAN DALAM MENGHADAPI DUNIA KERJA PADA MAHASISWA UNIVERSITAS 17 AGUSTUS 1945 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

RIYANITA, RIYANITA (2019) HUBUNGAN ANTARA HARGA DIRI DENGAN KECENDERUNGAN NARSISTIK PADA PENGGUNA MEDIA SOSIAL “INSTAGRAM” MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

RUHMA, MISFATUR (2016) HUBUNGAN ANTARA PENGETAHUAN TENTANG PEDOFILIA DENGAN KECEMASAN ORANG TUA TERHADAP KEKERASAN SEKSUAL PADA ANAK BERKEBUTUHAN KHUSUS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rachmad, Muhammad Suparjo (2020) HUBUNGAN KONFORMITAS TEMAN SEBAYA DENGAN PERILAKU PENYALAHGUNAAN NARKOBA JENIS PIL KOPLO PADA REMAJA LAKI-LAKI DI DESA P KECAMATAN S KABUPATEN D. Undergraduate thesis, Universitas Islam Sultan Agung.

Rachmadhani, Talita Iska Amalia (2022) HUBUNGAN ANTARA HIPERREALITAS DENGAN PERILAKU KONSUMTIF PADA GENERASI MILENIAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Rachman, Aprilia (2021) HUBUNGAN ANTARA POLA ASUH PERMISIF KELUARGA MUSLIM DAN MOTIVASI BELAJAR DENGAN PRESTASI BELAJAR SISWA SMP NU 1 WELERI. Undergraduate thesis, Universitas Sultan Agung.

Rachmasari, Winika Aini (2021) HUBUNGAN ANTARA CITRA TUBUH DAN KONSEP DIRI TERHADAP PERILAKU KONSUMTIF PEMBELIAN KOSMETIK PADA MAHASISWI. Undergraduate thesis, Universitas Islam Sultan Agung.

Rachmawati, Anita Muthia (2017) HUBUNGAN ANTARA KESADARAN DIRI DENGAN PERILAKU PROLINGKUNGAN PADA MAHASISWA PECINTA ALAM UNISSULA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rachmawati, Lysa Amorita (2014) HUBUNGAN ANTARA PERSEPSI SISWA TERHADAP IKLIM SEKOLAH DENGAN KECENDERUNGAN PERILAKU BULLYING PADA SISWA SMP 2 SEPULUH NOPEMBER SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rachmayanti, Nadia Salsabila (2019) HUBUNGAN ANTARA EMOTION FOCUSED COPING DAN REGULASI EMOSI DENGAN RESILIENSI PADA MAHASISWA TAHUN PERTAMA FAKULTAS KEDOKTERAN GIGI UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, Universitas Islam Sultan Agung.

Raharjo, Chandra Audree (2018) HUBUNGAN ANTARA KETAKUTAN AKAN KEGAGALAN DENGAN PROKRASTINASI AKADEMIK PADA MAHASISWA JURUSAN TEKNIK MESIN UNNES. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rahayu, Devi (2023) PENGARUH PERLAKUAN DIGITAL DECLUTTERING UNTUK MENURUNKAN STRES AKADEMIK PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Rahayu, Ika Puji (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN COPING STRES DENGAN KECEMASAN MENGHADAPI BANTUAN KENDALI OPERASI (BKO) PADA ANGGOTA SATBRIMOB DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Rahayu Pertiwi, Sari (2015) HUBUNGAN ANTARA EFIKASI DIRI DAN STRES KERJA PADA GURU SEKOLAH LUAR BIASA NEGERI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rahia, Dino Rizadman (2015) PERILAKU KORUPSI DITINJAU DARI RASA SYUKUR TERHADAP GAJI PADA PEGAWAI KANTOR PELAYANAN PAJAK PRATAMA KOTA X. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rahma, Rizkia Nisaul (2021) HUBUNGAN CITRA MEREK DAN KUALITAS PRODUK TERHADAP PERILAKU KONSUMTIF PADA MAHASISWA FAKULTAS PSIKOLOGI ANGKATAN 2017 – 2019 UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Rahmadhany, Choirunissa Ayu (2019) HUBUNGAN ANTARA INTENSITAS PENGGUNAAN GADGET DAN KETERAMPILAN SOSIAL DENGAN MOTIVASI BERPRESTASI PADA SISWA SMA ISLAM HIDAYATULLAH SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Rahmadila, Barika Asya Niagi (2023) HUBUNGAN ANTARA EFIKASI DIRI DENGAN SELF MANAGEMENT PADA SISWA SMA NEGERI 1 BANGSRI. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Rahmah, Alifia Nisaur (2017) HUBUNGAN ANTARA PENYESUAIAN SOSIAL DENGAN KEPUTUSAN PEMBELIAN BARANG BERMEREK PADA REMAJA PUTRI DI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rahmania, Qonita (2014) PERAN CAREGIVER TERHADAP PERKEMBANGAN SOSIAL DAN EMOSI ANAK TUNARUNGU. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rahmanto, Septian Wahyu (2019) HUBUNGAN ANTARA EFIKASI DIRI DAN KESIAPAN KERJA DENGAN KECEMASAN MENGHADAPI DUNIA KERJA PADA MAHASISWA TINGKAT AKHIR DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Rahmawati, Karina Chandra Nur (2019) HUBUNGAN ANTARA KETERBUKAAN DIRI DENGAN KOMUNIKASI INTERPERSONAL REMAJA DI MA “X” SUKOREJO KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Rahmawati, Karina Chandra Nur (2020) HUBUNGAN ANTARA KETERBUKAAN DIRI DENGAN KOMUNIKASI INTERPERSONAL REMAJA DI MA “X” SUKOREJO KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Rahmawati, Mellenia Amanda (2023) HUBUNGAN ANTARA EFIKASI DIRI DENGAN STRES PADA MAHASISWA AKHIR YANG SEDANG MENGERJAKAN SKRIPSI DI FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Rahmi Mirdayanti, Syamsul (2015) KETAKUTAN SUKSES WANITA DITINJAU DARI KONFLIK PERAN GANDA DAN MOTIVASI BERPRESTASI PADA DOSEN WANITA UNIVERSITAS ISLAM SULTAN AGUNG (UNISSULA) SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rajab, Sahru (2017) HUBUNGAN ANTARA STRES KERJA DAN EFIKASI DIRI DENGAN KECEMASAN PADA PERAWAT DIRUMAH SAKIT ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ramadhan, Fajar Azhari (2023) PENGARUH ANTARA KONTROL DIRI DAN INSECURE ATTACHMENT TERHADAP DATING VIOLENCE PADA MAHASISWA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Ramadhan, Hilda (2017) HUBUNGAN ANTARA CULTURE SHOCK DENGANPENYESUAIAN DIRI PADA MAHASISWA LUAR JAWADI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ramadhani, Dyon Seno (2022) HUBUNGAN ANTARA KOMITMEN ORGANISASI DENGAN PERILAKU ORGANISASI (ORGANIZATIONAL CITIZENSHIP BEHAVIOR) PADA ANGGOTA RESIMEN MAHASISWA MAHADIPA SUB A JAWA TENGAH. Undergraduate thesis, Universitas Islam Sultan Agung.

Ramadhani, Ika Pebrina (2016) PERBEDAAN STRATEGI COPING MAHASISWA GELAR GANDA DENGAN MAHASISWA REGULER UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rany, Novia Waskita (2022) GAMBARAN RESILIENSI PADA REMAJA PUTRI PASCA KEMATIAN IBU DI KABUPATEN KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Renanthera Pranatajaya, Gena (2023) HUBUNGAN KONSEP DIRI DENGAN PENYESUAIAN PERKAWINAN PADA PASANGAN MENIKAH USIA MUDA DI KELURAHAN PURWODADI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Retnowati, Risha Ayu (2018) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN EFIKASI DIRI DENGAN PENGAMBILAN KEPUTUSAN KARIR PADA SISWA SMK N 1 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ridhowati, Della Karunia (2017) HUBUNGAN ANTARA PENYESUAIAN DIRI DENGAN KONFORMITAS PADA SISWA KELAS X SMK NU UNGARAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rihartini, Rika (2021) HUBUNGAN ANTARA EFIKASI DIRI DAN DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN STRES AKADEMIK PADA MAHASISWA SANTRI DI PESANTREN AS-SA’ADAH TERBOYO SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Rimawati, Anik (2021) HUBUNGAN ANTARA POLA ASUH OTORITER ORANGTUA DENGAN KENAKALAN REMAJA SISWA KELAS X DAN XI MA X KABUPATEN PATI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Risaryafi, Atillah Faiza (2023) HUBUNGAN ANTARA DUKUNGAN SOSIAL DAN OPTIMISME MASA DEPAN DENGAN KEBAHAGIAAN SISWA SMA ISLAM AL-AZHAR 14 SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Riskiani, Diana Rohmatul (2023) HUBUNGAN ALEXITHYMIA DENGAN KECEMBURUAN PADA MAHASISWA YANG BERPACARAN DI FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Rismandanni, Wahyu Putri (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN RESILIENSI REMAJA YANG BERPISAH DARI ORANG TUA. Undergraduate thesis, Universitas Islam Sultan Agung.

Ristanti, Linda (2023) HUBUNGAN ANTARA KOMUNIKASI INTERPERSONAL DENGAN KEPUASAN KERJA PADA PERAWAT RUMAH SAKIT ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ristriyanti, Mahalina (2014) HUBUNGAN ANTARA KEPUASAN KOMUNIKASI DENGAN ORGANIZATIONAL CITIZENSHIP BEHAVIOR (OCB) PADA KARYAWAN PT.DJARUM KUDUS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Riyanto, Arinda Ayudya Putri (2023) HUBUNGAN CITRA DIRI DAN KOMUNIKASI INTERPERSONAL TERHADAP KEPERCAYAAN DIRI PADA ANGGOTA CAMPUS AMBASSADOR “WARDAH BEAUTY CIRCLE”. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Rizad, Khairul (2019) HUBUNGAN ANTARA PERSEPSI TERHADAP GAJI DENGAN KEPUASAN KERJA PADA KARYAWAN DI GETS HOTEL SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Rizki, Iin Tri (2016) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN KETERBUKAAN DIRI PADA PEMANDU KARAOKE PLUS SUNAN KUNING SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rizki, Mita Meylina (2016) HUBUNGAN ANTARA PSYCHOLOGICAL MEANING OF MONEY DAN KONSEP DIRI DENGAN GAYA HIDUP HEDONIS PADA KARYAWAN BANK BERSUKU JAWA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rizki, Noviarini (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL ORANG TUA DENGAN MOTIVASI BELAJAR SANTRIWATI PADA SANTRI PONDOK PESANTREN X KOTA SOLO. Undergraduate thesis, Universitas Islam Sultan Agung.

Rizkiano, Muhammad Jovan (2022) HUBUNGAN ANTARA STRES DENGAN PERILAKU MEROKOK PADA MAHASISWA S1 FAKULTAS TEKNIK ANGKATAN 2019 - 2021 UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Rizkina, Ulfi Mahroja (2019) HUBUNGAN ANTARA KONSEP DIRI DAN KONFORMITAS TERHADAP PERILAKU BULLYING PADA SISWA SMA PONDOK MODERN SELAMAT KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Rizky, Puput Mentari (2017) HUBUNGAN ANTARA KEPERCAYAAN INTERPERSONAL DAN RELIGIUSITAS DENGAN PEMAAFAN PADA REMAJA AKHIR. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rizky Anggraeni, Bella (2022) PENGARUH INTENSITAS MENONTON YOUTUBE NCT TERHADAP PARASOCIAL RELATIONSHIP PADA NCTZEN DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Rizqi, Miftahur (2023) HUBUNGAN ANTARA KECERDASAN EMOSI DENGAN AGRESIVITAS PADA KOMUNITAS MOTOR DI TEGAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Robby, Pingka Gusti Fadlilati (2019) PERAN KUALITAS PELAYANAN TERHADAP KEPUASAN MAHASISWA FAKULTAS XY DI UNIVERSITAS Z KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Robby, Pingka Gusti Fadlilati (2020) PERAN KUALITAS PELAYANAN TERHADAP KEPUASAN MAHASISWA FAKULTAS XY DI UNIVERSITAS Z KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Rochman, Muhammad Abdur (2016) TINJAUAN MASLAHAT TERHADAP DISPENSASI NIKAH MENURUT HAKIM PENGADILAN AGAMA SEMARANG. SKRIPSI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rochmati, Arista Agustiani (2015) INTENSI KORUPSI DITINJAU DARI NORMA SUBJEKTIF DAN DURASI KEANGGOTAAN PADA AKTIVIS PARTAI POLITIKGK, GR, SERTA PI DI KABUPATEN TEGAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rochmatun, Siti (2022) HUBUNGAN ANTARA PERSEPSI TERHADAP GAYA KEPEMIMPINAN OTORITER DENGAN KEPUASAN KERJA PADA KARYAWAN PT. X. Undergraduate thesis, Universitas Islam Sultan Agung.

Rohmaniah, Alfiatur (2019) KEPUASAN PERNIKAHAN PADA ISTRI NARAPIDANA. Undergraduate thesis, Universitas Islam Sultan Agung.

Rohmawati, Nurul (2020) HUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN KEBAHAGIAAN PADA REMAJA DI PESANTREN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Rohmi, Endah Nur (2016) KECENDERUNGAN BODY DYSMORPHIC DISORDERDITINJAU DARI SELF ESTEEM DAN REJECTION SENSITIVITY PADA REMAJA PUTRI DI SMA N I JEPARA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rona, Emira Firdaus (2017) IMPULSIVE BUYING PADA REMAJA DITINJAU DARI KONTROL DIRI DAN JENIS KELAMIN DI SMA N 1 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ronald Setiadi, Yunior (2021) HUBUNGAN ANTARA HARGA DIRI DENGAN KESEPIAN PADA MAHASISWA RANTAU DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Roselina, Sindy (2020) HUBUNGAN ANTARA EFIKASI DIRI DAN PERILAKU MENYONTEK PADA SISWA SMA X DI CIREBON. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Rosidaningrum, Eka Yustrikarini Alriayulfa (2017) HUBUNGAN ANTARA PENGETAHUAN KESEHATAN REPRODUKSI DAN KONTROL DIRI DENGAN PERILAKU SEKSUAL PADA REMAJA SISWA SMA X KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rosyada, Vaza Amrina (2015) PENGARUH STRATEGI METAKOGNITIF DALAM METODE PEMBELAJARAN KOOPERATIF TERHADAP KETERAMPILAN BAHASA INGGRIS PADA SISWA KELAS VII MTs X. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Rosyidah, Fatma Khulafaur (2020) HUBUNGAN ANTARA PENYESUAIAN AKADEMIK DAN MANAJEMEN WAKTU TERHADAP STRES AKADEMIK PADA MAHASISWA JURUSAN FARMASI DI UNIVERSITAS X SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Rr. Maharany Mega Wibiyandaru Putri, Rr. Maharany Mega Wibiyandaru Putri (2019) HUBUNGAN ANTARA RELIGIUSITAS DENGAN PERILAKU SEKSUAL PRA-NIKAH PADA MAHASISWA YANG TINGGAL DI RUMAH KOS. Undergraduate thesis, Universitas Islam Sultan Agung.

Rusfiana, Rossy (2021) HUBUNGAN ANTARA BERPIKIR POSITIF DENGAN HARGA DIRI PADA KARYAWAN PENYAPU JALAN DI DINAS LINGKUNGAN HIDUP KABUPATEN JEPARA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

S

SANTOSO, FAJAR (2022) HUBUNGAN ANTARA KEMANDIRIAN BELAJAR DAN RESILIENSI AKADEMIK SISWA SMK N 1 SAYUNG DALAM MENGIKUTI PEMBELAJARAN BLENDED LEARNING. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

SAPUTRI, FITRA (2010) HUBUNGAN ANTARA KEPUASAN SEKSUAL DENGAN INTENSI UNTUK BERSELINGKUH PADA SUAMI DI PERUMAHAN "X" KOTASEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

SARI, TRI MAULIDDIYAH (2023) HUBUNGAN ANTARA PERFEKSIONISME TERHADAP KELELAHAN AKADEMIK PADA SISWA SMA1 BAE KUDUS PASCA PANDEMI COVID-19. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

SETIYATI, JIMY NUR (2014) HUBUNGAN PERSEPSI TERHADAP MODEL IKLAN DENGAN MINAT MEMBELI HAND & BODY LOTIONCITRA PADA REMAJA PUTRI SMK ASSHODIQIYAH SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

SHOLIHAH, ANNISATU (2012) HUBUNGAN ANTARA PRASANGKA TERHADAP AMERIKA DAN SEKUTUNYA DENGAN SIKAP TERHADAP TERORISME PADA SANTRI PUTRI PONDOK PESANTREN X DI KOTA S. Undergraduate thesis, Fakultas Psikologi UNISSULA.

SULISTYANINGRUM, DWIRINTA (2004) PERBEDAAN KEPERCAYAAN DIRI REMAJA PENYANDANG CACAT FISIK DITINJAU DARI STATUS TEMPAT TINGGAL KELUARGA DAN ASRAMA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

SURYANINGTYAS, SALSABILLA SYERIA (2023) DINAMIKA PSIKOLOGIS TERBENTUKNYA BONDING SOCIAL CAPITAL PADA ANGGOTA ORGANISASI MAHASISWA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

SYARIFAH, NAILATUS (2022) HUBUNGAN ANTARA CITRA TUBUH DAN PERBANDINGAN SOSIAL DENGAN HARGA DIRI PADA MAHASISWI UNISSULA PENONTONTREND GLOW UP CHALLENGE DI TIKTOK. Undergraduate thesis, Universitas Islam Sultan Agung.

Safira, Afridatus (2023) PENGARUH DUKUNGAN SOSIAL TEMAN SEBAYA DAN KONSEP DIRI TERHADAP PENYESUAIAN DIRI PADA SANTRIWATI REMAJA YANG TINGGAL DI PONDOK PESANTREN NURUL QUR’AN KENDAL. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Safira, Aldia Bunga (2021) HUBUNGAN ANTARA PENYESUAIAN DIRI DENGAN KECEMASAN TERHADAP ISTRI TNI YANG DI TINGGAL PERGI BERTUGAS KE DAERAH RAWAN KONFLIK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Safitri, Dinda Nur (2016) HUBUNGAN ANTARA KONSEP DIRI DAN KEPERCAYAAN DIRI DENGAN KECEMASAN MENGHADAPI PENILAIAN MASYARAKAT PADA PEKERJA SEKS KOMERSIAL DI WILAYAH SUNAN KUNING SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Safitri, Lathifah Nur (2022) HUBUNGAN ANTARA KECERDASAN EMOSIONAL DAN MANAJEMEN KONFLIK PADA MAHASISWA ORGANISATOR UNIVERSITAS X DI KOTA TEGAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Safitri, Rindu (2023) HUBUNGAN ANTARA STRESS KERJA DENGAN KEPUASAN KERJA PADA KARYAWAN TAMBAK BBPBAP JEPARA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sahesti, Mu’almar Hartatriana (2022) HUBUNGAN ANTARA POLA ASUH PERMISIF DENGAN PERILAKU SEKS PADA REMAJA. Undergraduate thesis, Universitas Islam Sultan Agung.

Saktiawan, Muhammad Dias (2017) TINJAUAN YURIDIS TERHADAP GRASI DALAM PERSPEKTIF HUKUM PIDANA DI INDONESIA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Salsabila, Inan Tuada (2022) DINAMIKA PSIKOLOGIS PEREMPUAN DEWASA AWAL YANG MENGALAMI QUARTER LIFE CRISIS. Undergraduate thesis, Universitas Islam Sultan Agung.

Salsabila, Insira (2022) MAKNA HIDUP PRIA TRANSGENDER DI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Salsabila, Jihan Shofa (2023) HUBUNGAN ANTARA BODY IMAGE DENGAN PERILAKU MAKAN PADA MAHASISWI. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Salsabila, Salsabila (2019) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DAN KECERDASAN EMOSI DENGAN KEDISIPLINAN REMAJA PUTRI DI PONDOK PESANTREN. Undergraduate thesis, Universitas Islam Sultan Agung.

Salsabila, Salsabila (2019) HUBUNGAN ANTARA KONTROL DIRI DENGAN KECANDUAN INTERNET PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Salsabila, Salsabila (2020) HUBUNGAN ANTARA KONTROL DIRI DENGAN KECANDUAN INTERNET PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Salsabila, Syifa Novistia (2023) HUBUNGAN ANTARA FATHERLESS DENGAN SELF ESTEEM PADA SISWA SMK BHAKTI PRAJA TALANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Salsana, Keysha Adi (2021) HUBUNGAN ANTARA CITRA TUBUH DENGAN PERILAKU DIET PADA PEREMPUAN DI SANGGAR SENAM NADINE SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Samridin, Samridin (2018) HUBUNGAN ANTARA GAYA MENGAJAR GURU DENGAN MOTIVASI BERPRESTASI SISWA DI SMA ISLAM ISLAM SULTAN AGUNG 3 SEMARANG. Undergraduate thesis, Fakultas Ekonomi UNISSULA.

Samsuri, Mutiara (2016) HUBUNGAN ANTARA HARGA DIRI DAN RELIGIUSITAS DENGAN PERILAKU MINUM MINUMANBERALKOHOL PADA MAHASISWA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sanaria, Sanaria (2016) HUBUNGAN ANTARA KONSEP DIRI DAN DUKUNGAN SOSIAL SUAMI TERHADAP PENERIMAAN DIRI PADA IBU YANG MEMILIKI ANAK AUTIS DI SLB NEGERI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Santoso, Marjo Adi (2017) GAMBARAN RASA BERSALAH (GUILTY FEELING) PADANARAPIDANA PELAKU PEMERKOSAAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Saoki, Muhammad Aqil Ali (2022) HUBUNGAN ANTARA KECANDUAN GAME ONLINE DAN AGRESIVITAS PADA REMAJA DI KELURAHAN X DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Saputra, Aditya Ghanni (2023) HUBUNGAN ANTARA ALTRUISME DENGAN PERSEPSI TERHADAP BEBAN KERJA PADA GURU SLB DI GURU KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Saputra, Aris Abdul Ra’is (2021) HUBUNGAN ANTARA MANAJEMEN WAKTU TERHADAP PROKRASTINASI AKADEMIK PADA PELAJAR DI SMA N 10 SEMARANG. Undergraduate thesis, Universitas Sultan Agung.

Saputra, Denny (2017) PRINSIP KEHATI-HATIAN BAGI NOTARIS/PPAT DALAM MENJALANKAN JABATANNYA DALAM UPAYA PENCEGAHAN KRIMINALISASI BERDASARKAN KODE ETIK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Saputri, Amanda Eka (2023) HUBUNGAN ANTARA KESEPIAN DENGAN STRES AKADEMIK PADA MAHASISWA RANTAU S1 TAHUN PERTAMA DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Saputri, Ulya Noor (2017) HUBUNGAN ANTARA KONTROL DIRI DAN PENYESUAIAN DALAM KELUARGA DENGAN KENAKALAN DI SEKOLAH “X” SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Saputri, Yenny Arum (2017) HUBUNGAN ANTARA KONFORMITAS DENGAN PERILAKU KONSUMTIF PADA REMAJA PUTRI SMA ISLAM SULTAN AGUNG 3 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Saputri, Yuli Budi (2021) HUBUNGAN ANTARA KOMUNIKASI INTERPERSONAL DAN RELIGIUSITAS TERHADAP KEPUASAN PERNIKAHAN PADA WANITA YANG BEKERJA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sari, Azizah Permata (2023) HUBUNGAN ANTARA KONTROL DIRI DENGAN NOMOPHOBIA PADA MAHASISWA SANTRI PEREMPUAN DI PESANTREN PUTRI AS-SA’ADAH TERBOYO SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Sari, Desyia Triana (2019) HUBUNGAN ANTARA KOHESIVITAS KELOMPOK DAN MOTIVASI BERPRESTASI DENGAN KEMALASAN SOSIAL PADA SISWA SMA. Undergraduate thesis, Universitas Islam Sultan Agung.

Sari, Dita Ratna (2022) HUBUNGAN INTERNAL LOCUS OF CONTROL DAN EFIKASI DIRI DENGAN KEMATANGAN KARIR PADA SISWA SMA KELAS XII. Undergraduate thesis, Universitas Islam Sultan Agung.

Sari, Farida Novita (2017) PERLINDUNGAN HUKUM TERHADAP HARTA DALAM AKTA PERJANJIAN KAWIN YANG DIBUAT OLEH NOTARIS BAGI WARGA NEGARA INDONESIA YANG BERAGAMA ISLAM. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sari, Heni Ratna (2018) PERAN EFIKASI DIRI DAN DUKUNGAN SOSIAL TEMAN SEBAYA TERHADAP BELAJAR BERDASAR REGULASI DIRI PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sari, Hevi Mita (2020) HUBUNGAN ANTARA KEMATANGAN EMOSI DAN KONTROL DIRI DENGAN STRES KERJA PADA PERAWAT RSJD Dr. AMINO GONDOHUTOMO PROVINSI JAWA TENGAH. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sari, Indriani Kafita (2021) PENGARUH PERSEPSI KEMUDAHAN DAN HARGA TERHADAP KEPUTUSAN PEMBELIAN PULSA SECARA ONLINE (E-COMMERCE) PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Sari, Nur Handayani Widya (2015) HUBUNGAN ANTARA EFIKASI DIRI DAN PROBLEM-FOCUSED COPING DENGAN BURNOUT PADA MAHASISWA YANG SEDANG MENGERJAKAN SKRIPSI DI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sari, Prawesti Arum (2016) HUBUNGAN ANTARA SIKAP DAN NORMA SUBJEKTIF TERHADAP INTENSI MENGKONSUMSI PIL KOPLO PADA REMAJA DESA X KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sari, Prima Rizky Rahma (2015) HUBUNGAN ANTARA EFIKASI DIRI DAN DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN KECEMASAN MENGHADAPI UJIAN NASIONAL PADA SISWA KELAS IX MTs NU UNGARAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sari, Sarlinda Dian (2016) PERILAKU KERJA KONTRAPRODUKTIF DALAM KAITANNYA DENGAN IMMATURE DEFENSE MECHANISM, PEMUTUSAN KONTRAK PSIKOLOGIS DAN KOMITMEN ORGANISASI KARYAWAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sari, Siska Amelia (2023) HUBUNGAN ANTARA DUKUNGAN SOSIAL SAHABAT DENGAN KECEMASAN PRESENTASI PADA MAHASISWA FAKULTAS EKONOMI UNISSULA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Sasfiranti, Yuni (2021) HUBUNGAN ANTARA KEBERMAKNAAN HIDUP DENGAN DEPRESI PADA SISWA SMA X DAN MA Y DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Satriani, Satriani (2017) HUBUNGAN ANTARA KEMATANGAN EMOSI DENGAN PENGAMBILAN KEPUTUSAN KARIR PADA SISWA SMA N 10 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sauma Puspitaningtyas, Shinta (2023) RESILIENSI TENAGA KESEHATAN DI ERA PANDEMI COVID-19. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Savitri, Elyna Norma Amalia (2021) HUBUNGAN ANTARA KONTROL DIRI DAN FOMO (FEAR OF MISSING OUT) TERHADAP KECENDERUNGAN ADIKSI MEDIA SOSIAL PADA GENERASI Z YANG BERSTATUS MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Savitri, Nadya (2017) HUBUNGAN ANTARA KONSEP DIRI DENGAN KEBERMAKNAAN HIDUP PADA PASIEN GAGAL GINJAL KRONIK YANG MENJALANI TERAPI HEMODIALISIS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sa’adah, Dian Naeli (2021) HUBUNGAN ANTARA KEPERCAYAAN DIRI DAN KONFORMITAS KELOMPOK DENGAN PERILAKU KONSUMTIF PADA MAHASISWA BIDIKMISI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sa’diah, Halimatus (2020) HUBUNGAN ANTARA REGULASI DIRI DAN MANAJEMEN WAKTU DENGAN PERILAKU PROKRASTINASI AKADEMIK PADA SISWA SMA “X” KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sa’idatilah, Umi (2021) EFEKTIVITAS PEMBELAJARAN DARING PADA MATA PELAJARAN AL-QUR’AN HADIS DI KELAS VI-C SD BUSTANU USYSYAQIL QUR’AN (BUQ) BETENGAN DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

Sekarayu, Belinda Filita (2019) HUBUNGAN KEPERCAYAAN DIRI DAN EFIKASI DIRI DENGAN KECEMASAN BERBICARA DI DEPAN UMUM PADA MAHASISWA FAKULTAS HUKUM UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Sekarayu, Belinda Filita (2020) HUBUNGAN KEPERCAYAAN DIRI DAN EFIKASI DIRI DENGAN KECEMASAN BERBICARA DI DEPAN UMUM PADA MAHASISWA FAKULTAS HUKUM UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sembada, Tidar Wira (2016) HUBUNGAN ANTARA PERSEPSI KETERAMPILAN KOMUNIKASI PASANGAN DENGAN KEPUASAN PERNIKAHAN PADA REMAJA PUTRI DI DESA GUNUNGSARI REMBANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Septian Prakusa, Bayu (2023) HUBUNGAN ANTARA KONTROL DIRI (self-control) TERHADAP PERILAKU MENYIMPANG PADA SISWA KELAS XI DI SMA Y WILAYAH DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Septiani Pasyoranda Fikri, Rahma (2023) HUBUNGAN ANTARA KONFORMITAS DENGAN MOTIVASI BELAJAR PADA MAHASISWA PSIKOLOGI UNISSULA ANGKATAN 2019-2021. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Septianugroho, Amir (2018) HUBUNGAN ANTARA KEPUASAN KERJA DENGAN TURNOVER INTENTION KARYAWAN PADA PT. MAJAU INTI JAYA SITE SAMBARATA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Septyawan, Mohamad Yusuf (2018) HUBUNGAN ANTARA INTENSITAS BERMAIN GAME ONLINE DENGAN AGRESIVITAS REMAJA DI KECAMATAN PEDURUNGAN KOTA SEMARANG. Undergraduate thesis, Fakultas Ekonomi UNISSULA.

Setiani, Zhalilla Viola Risqa (2021) HUBUNGAN ANTARA POLA ASUH OTORITER DAN STRES AKADEMIK TERHADAP REGULASI EMOSI PADA SISWA SMA X KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Setianingrum, Amirul (2019) HUBUNGAN ANTARA KESADARAN DIRI PADA IBU PENGENDARA SEPEDA MOTOR DENGAN KEPATUHAN DALAM BERLALU LINTAS DI KAMPUNG KEBONHARJO SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Setiawan, Arif Agung (2014) DINAMIKA PSIKOLOGIS PENERIMAAN DIRI ODHA IBU RUMAH TANGGA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Setiawati, Dwi (2016) HUBUNGAN ANTARA GEGAR BUDAYA DAN PENYESUAIAN DIRI PADA SISWA KELAS VII YANG TINGGAL DI PONDOK PESANTREN MODERN ISLAM AS SALAM SURAKARTA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Setiyo, Teguh (2017) KONFLIK RELIGIUSITAS PADA HOMOSEKSUAL (Studi Fenomenologi Gay yang Bekerja sebagai Massage Escort). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Setiyorini, Anis (2017) Hubungan antara Kecerdasan Emosi dan Tingkat Stress Terhadap Program Wajib Asrama dan Penerapan Pendidikan Semi Militer pada Taruna Politeknik Ilmu Pelayaran Semarang. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Setiyorini, Dwi Wahyuning (2015) DISONANSI KOGNITIF PADA REMAJA YANG PERNAH MELAKUKAN ABORSI DI KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Setyowati, Endang (2004) MOTIVASI BERPRESTASI DITINJAU DARI KEPERCAYAAN DIRI PADA SISWA SMU NEGERI 1 KARANG TENGAH DEMAK. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Shabrina El Hadi, Vicky (2023) HUBUNGAN ANTARA RELASI TEMAN SEBAYA DENGAN PENYESUAIAN DIRI PARA SANTRIWATI ASRAMA PUTRI AL-KHUSNA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Shafira, Anissa Indah (2018) “PERBEDAAN STRES KERJA DAN BURNOUT PADA GURU SEKOLAH DASAR REGULAR DAN GURU SEKOLAH DASAR LUAR BIASA BAGIAN B DAN C DI KOTA SEMARANG”. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Shaputra, Agung Wahyu (2021) HUBUNGAN ANTARA STRATEGI COPING DENGAN RESILIENSI PADA MAHASISWA RANTAU DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Sultan Agung.

Shefiet Chandra Kusuma, Putra (2022) HUBUNGAN ANTARA RELIGIUSITAS DENGAN TURN OVER PADA KARYAWAN PT X BOJA KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Shimatul Asqiyya, Nivenia (2023) HUBUNGAN ANTARA KECERDASAN ADVERSITAS TERHADAP ADAPTABILITAS KARIR PADA MAHASISWA TINGKAT AKHIR DI FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG PADA MASA PANDEMI COVID-19. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Shinta, Marga (2006) HUBUNGAN ANTARA DUKUNGAN SOSIAL KELUARGA DENGAN PENERIMAAN DIRI PADA PENDERITA DIABETES MELITUS DI KELURAHAN NGALIYAN DAN TAMBAK AJI KECAMATAN NGALIYAN KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Shiqliyya, Nila (2021) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA DAN GAYA HIDUP BRAND MINDED SKINCARE DENGAN PEMBELIAN IMPULSIF PADA MAHASISWI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Shodikin, Ahmad (2019) HUBUNGAN ANTARA KONFORMITAS KELOMPOK DENGAN KENAKALAN REMAJA DI SMK X DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

Shodikin, Ahmad (2020) HUBUNGAN ANTARA KONFORMITAS KELOMPOK DENGAN KENAKALAN REMAJA DI SMK X DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Shoffa, Annisa Fa’ila (2023) HUBUNGAN ANTARA KONFORMITAS DAN KONTROL DIRI DENGAN PERILAKU KONSUMTIF PADA PENGGEMAR K-POP DI SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Sholihah, Anissa Amaliya (2023) HUBUNGAN ANTARA CITRA TUBUH DENGAN KEPERCAYAAN DIRI PADA SISWA MADRASAH ALIYAH NAHDLATUL ULAMA DEMAK. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Sichatillah, Elva Nur (2023) HUBUNGAN ANTARA KELEKATAN ORANG TUA DAN KEMATANGAN EMOSI DENGAN PERILAKU PROSOSIAL SISWA SMA X. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sihri, Achmad Zakki Anna (2017) HUBUNGAN ANTARA PENYESUAIAN DIRI DENGAN KECEMASAN MAHASISWA FAKULTAS KEDOKTERAN UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG KETIKA AKAN MELAKSANAKAN PRAKTIKUM ANATOMI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Silahudin, Rahmad (2018) PERAN PENYIDIK DALAM PENYELESAIAN TINDAK PIDANA NARKOTIKA (Studi Kasus di Polrestabes Semarang). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Silfiana, Richa Yuli (2020) HUBUNGAN KOMUNIKASI INTERPERSONAL DAN MANAJEMEN KONFLIK DENGAN KEPUASAN PERNIKAHAN PADA ISTRI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Silfiana, Richa Yuli (2019) HUBUNGAN KOMUNIKASI INTERPERSONAL DAN MANAJEMEN KONFLIK DENGAN KEPUASAN PERNIKAHAN PADA ISTRI. Undergraduate thesis, Universitas Islam Sultan Agung.

Silviana, Oktavia Melyssa (2021) HUBUNGAN ANTARA PERUNDUNGAN SIBER DENGAN HARGA DIRI PADA SISWA SMA NEGERI 1 DONOROJO JEPARA. Undergraduate thesis, Universitas Islam Sultan Agung.

Sintiya, Filiana Ayu (2021) Hubungan Antara Psychologycal Meaning of Money Dan Konformitas Kelompok Terhadap Perilaku Konsumtif Melalui E-Commerce Shopee Pada Mahasiswa Psikologi Angkatan 2017-2019 UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sitompul, Deo Denaldo (2022) MODAL PSIKOLOGIS DAN KETERLIBATAN KERJA PADA PELAKU WIRAUSAHA DIMASA PANDEMI. Undergraduate thesis, Universitas Islam Sultan Agung.

Sofiyanti, Umi (2022) HUBUNGAN ANTARA PERSEPSI TERHADAP GAYA KEPEMIMPINAN DENGAN KINERJA PEGAWAI DI KANTOR BADAN PENGELOLAAN KEUANGAN DAERAH (BPKD) KABUPATEN PEKALONGAN. Undergraduate thesis, Universitas Islam Sultan Agung.

Sofyanti, Zumrotul Khoiriyyah (2023) HUBUNGAN ANTARA KEPUASAN KERJA DAN LINGKUNGAN KERJA TERHADAP KINERJA PERAWAT PADA RUMAH SAKIT X. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Solichah, Zaidatus (2015) PENGARUH MENULIS EKSPRESIF “PENGALAMAN EMOSIONAL” TERHADAP EMOSI MARAH PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Solikha, Imroatus (2022) HUBUNGAN ANTARA INTENSITAS PENGGUNAAN MEDIA SOSIAL DENGAN FEAR OF MISSING OUT (FOMO) PADA SISWA SMP N X. Undergraduate thesis, Universitas Islam Sultan Agung.

Sopiyah, Siti (2022) PENGARUH ANTARA WORKPLACE BULLYING TERHADAP KINERJA KARYAWAN X MOTOR BREBES DENGAN SELF ESTEEM SEBAGAI VARIABEL MODERATING. Undergraduate thesis, Universitas Islam Sultan Agung.

Sri Lestari, Dwi (2022) HUBUNGAN ANTARA PERSEPSI TERHADAP SELEBGRAM ENDORSEMENT DENGAN PERILAKU KONSUMTIF MAHASISWA PADA PRODUK KOSMETIK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Subekti, Anggita Ragil (2022) HUBUNGAN ANTARA FUTURE TIME PERSPECTIVE TERHADAP KEMATANGAN KARIR PADA MAHASISWA TINGKAT AKHIR DI UNIVERSITAS ISLAM SULTAN AGUNG KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Suci, Wahyu Sekar (2022) HUBUNGAN ANTARA PENYESUAIAN DIRI DENGAN OPTIMISME PADA SANTRI PENGHAFAL AL-QUR'AN DI PONDOK PESANTREN AL-MUBAROK MRANGGEN DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

Suciati, Retno Wulan (2017) HUBUNGAN ANTARA MENCARI SENSASI DAN HARGA DIRI DENGAN PERILAKU SEKSUAL PADA BACKPACKER DI KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sudewo, Deni Cipta Mulya (2019) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN ASERTIVITAS PADA MAHASISWA AKTIVIS ORGANISASI DI FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Sudewo, Deni Cipta Mulya (2020) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN ASERTIVITAS PADA MAHASISWA AKTIVIS ORGANISASI DI FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sudibyo, Gustaaf (2021) HUBUNGAN ANTARA KONSEP DIRI TERHADAP MOTIVASI BELAJAR PADA MAHASISWA PSIKOLOGI UNISSULA ANGKATAN 2018. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sugandini, Niken (2023) HUBUNGAN ANTARA DUKUNGAN KELUARGA TERHADAP PERILAKU CYBERBULLYING PADA SISWA SMK AL-FALAH WINONG PATI. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Sugiarti, Zul Winar Sri (2017) HUBUNGAN ANTARA PERSEPSI MAHASISWA TERHADAP HARAPAN ORANG TUA DENGAN TINGKAT STRES DALAM MENYUSUN SKRIPSI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Suharnia, Wa Ode (2016) KONFLIK RELIGIUS PADA PEKERJA SEKS KOMERSIAL DI LOKALISASI SUNAN KUNING SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sukma, Laila Zulfani (2021) HUBUNGAN PEMBELAJARAN DARING DENGAN MOTIVASI BELAJAR MAHASISWA DI MASA PANDEMI COVID. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sukma, Thria Melati (2021) HUBUNGAN ANTARA EFIKASI DIRI DENGAN PENYESUAIAN DIRI PADA MAHASISWA TAHUN PERTAMA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Sukmawardani, Erianisa (2018) HUBUNGAN ANTARA ASERTIFITAS DENGAN KECENDERUNGAN MENJADI KORBAN PERUNDUNGAN PADA SISWA SMP N “X” SEMARANG. Undergraduate thesis, Fakultas Ekonomi UNISSULA.

Sukmawati, Alfira (2017) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN PENERIMAAN DIRI PADA PASIEN WANITA PENDERITA KANKER PAYUDARA PASCA MASTEKTOMI DI RUMAH SAKIT ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sulastina, Sulastina (2016) HUBUNGAN ANTARA RASA SYUKUR DENGAN KEPUASAN HIDUP PADA ORANG TUA YANG MEMILIKI ANAK BERKEBUTUHAN KHUSUS. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Sulistianingsih, Imas Ayu (2020) HUBUNGAN ANTARA DUKUNGAN SOSIAL KELUARGA DENGAN KEBERSYUKURAN NARAPIDANA KASUS NARKOTIKA DI LEMBAGA PERMASYARAKATAN KELAS 1 KEDUNGPANE SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Sunan, Muhamad Ali (2023) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN QUARTER LIFE CRISIS PADA MAHASISWA TINGKAT AKHIR FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Sunarsi, Sunarsi (2017) ¬HUBUNGAN ANTARA EFIKASI DIRI DENGAN STRES AKADEMIK PADA SISWA KELAS XISMA ISLAM SULTAN AGUNG 3 SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Supikati, Supikati (2015) HUBUNGAN ANTARA KONFORMITAS DENGAN PERILAKU MEROKOK PADA REMAJA AWAL DI MTS NU 19 PROTOMULYO KALIWUNGU SELATAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Suratno, Mega Fitriani (2021) FAKTOR-FAKTOR YANG MEMPENGARUHI REGULASI EMOSI PADA PASIEN KANKER. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Suratno, Mega Fitriani (2021) FAKTOR-FAKTOR YANG MEMPENGARUHI REGULASI EMOSI PADA PASIEN KANKER. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Susanti, Tria Nur (2019) HUBUNGAN ANTARA KONSEP DIRI DAN DUKUNGAN SOSIAL KELUARGA DENGAN PENERIMAAN DIRI PADA ORANGTUA YANG MEMILIKI ANAK KETERBELAKANGAN MENTAL. Undergraduate thesis, Universitas Islam Sultan Agung.

Sutriyatno, Adi (2016) HUBUNGAN ANTARA RASA SYUKUR DAN PENERIMAAN DIRI ORANGTUAYANG MEMILIKI ANAK BERKEBUTUHAN KHUSUS PENYANDANG TUNAGRAHITA DI SLB NEGERI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Suwarsi, Sri (2016) Hubungan Antara Optimisme denganProblem focused coping pada Mahasiswa yang Sedang Menyusun Skripsi. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Syadza, Nisrina (2016) HUBUNGAN ANTARA KONFORMITAS DAN KEMATANGAN EMOSI TERHADAP CYBERBULLYING PADA REMAJA SMPX DI KOTA PEKALONGAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Syafridha, Syafridha (2023) HUBUNGAN ANTARA FANATISME K-POP DENGAN PERILAKU CYBERBULLYING DI MEDIA SOSIAL PADA PENGGEMAR ARMY DI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Syahroni, Jihan Savia (2021) HUBUNGAN ANTARA SELF-EFFICACY DENGAN STRES AKADEMIK PADA SISWA SMA NEGRI 1 LASEM KETIKA MENGIKUTI PEMBELAJARAN MELALUI DARING. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Syahroni, Kunthi Ismu (2017) KOMITMEN TUGAS PADA MAHASISWI YANG SUDAH MENIKAH DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Syarafina, Nadya Priscillia (2019) HUBUNGAN ANTARA KONSEP DIRI DAN PERILAKU OVERPROTECTIVE ORANG TUA DENGAN PENYESUAIAN DIRI SISWA KELAS VII MTs NEGERI PEMALANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Syarifin, Andi Noor Faradiba (2015) HUBUNGAN ANTARA IDENTITAS SOSIAL DAN ATRIBUSI DENGAN PRASANGKA TERHADAP KELOMPOK LDII PADA MASYARAKAT PERUMAHAN GENUK INDAH SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Syifaurrahmi, Ana (2023) HUBUNGAN ANTARA KONFORMITAS TEMAN SEBAYA TERHADAP PERILAKU MENYONTEK PADA MURID SMP X DI ONGGORAWE DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Syihab, Ahmad Kholas (2016) HUBUNGAN ANTARA ORGANIZATIONALCITIZENSHIPBEHAVIORDENGAN KOMITMEN AFEKTIF ORGANISASI PADA PENGURUS PERGERAKAN MAHASISWA ISLAM INDONESIA KOMISARIAT SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

T

TAUFIQ, MUHAMMAD (2019) HUBUNGAN ANTARA MINAT TERHADAP BUDAYA KOREA DAN KONFORMITAS DENGAN PERILAKU KONSUMTIF DALAM MEMBELI PRODUK KOREA PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

TRISUSWADI, TRISUSWADI (2005) HUBUNGAN ANTARA LAMA KERJA DENGAN KEPUASAN KERJA PADA PRAMUNIAGA SWALAYAN ADA" MAJAPAHIT SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Tania, Vevie (2022) HUBUNGAN ANTARA EFIKASI DIRI DENGAN KECEMASAN BERBICARA DI DEPAN UMUM PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Taufiq, Muhammad (2020) HUBUNGAN ANTARA MINAT TERHADAP BUDAYA KOREA DAN KONFORMITAS DENGAN PERILAKU KONSUMTIF DALAM MEMBELI PRODUK KOREA PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Taufiq Amrullah, Muhammad (2004) HUBUNGAN ANTARA ASERTIFITAS DENGAN PRESTASI BELAJAR PADA SISWA-SISWI MADRASAH ALIYAH NURUL ULUM MRANGGEN DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ta’alluqy, Irfa’anna (2016) HUBUNGAN ANTARA KONFORMITAS DENGAN PERILAKU BERBOHONG PADA SANTRI PONDOK PESANTREN X DI KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Tiarani, Nandya (2015) PENYESUAIAN DIRI DAN PENERIMAAN KELUARGA PADA KELUARGA PENDERITA SKIZOFRENIA PASCA RAWAT-INAP DI RSJ. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Tristanti, Windy Widia (2016) HUBUNGAN ANTARA KONSEP DIRI DAN KONFORMITAS DENGAN GAYA HIDUP HEDONIS PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Tsuroyya, Yumna Bilqis (2023) HUBUNGAN ANTARA HARGA DIRI DENGAN RESILIENSI KORBAN TOXIC RELATIONSHIP PADA WANITA DEWASA AWAL DI KELURAHAN GENUKSARI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Tyas, Retno Muktining (2016) HUBUNGAN ANTARAKONFORMITAS TEMAN SEBAYA DENGAN PERILAKU DUGEM PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

U

Ulfah, Dina Maria (2012) HUBUNGAN ANTARA PENERIMAAN DIRI DENGAN PERSEPSI TERHADAP KESEPIAN PADA REMAJA YANG TINGGAL DI PANTI ASUHAN DARUL AITAM WADLUAFA’ LASEM. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ulfiah, Asfirotun (2019) HUBUNGAN ANTARA DUKUNGAN SOSIAL ORANG TUA DENGAN KOMITMEN KARIR PADA SISWA SMA DAN SMK. Undergraduate thesis, Universitas Islam Sultan Agung.

Ulfiah, Asfirotun (2020) HUBUNGAN ANTARA DUKUNGAN SOSIAL ORANG TUA DENGAN KOMITMEN KARIR PADA SISWA SMA DAN SMK. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Uli Nailatis Sangadah, Uli Nailatis Sangadah (2017) HUBUNGAN ANTARA EMPATI DENGAN PEMAAFAN DALAM PERNIKAHAN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Ulinnuha, Yusuf Adib (2022) HUBUNGAN ANTARA GAYA HIDUP DENGAN SIKAP PEDULI LINGKUNGAN PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Ulinuha, Asma Reza (2023) HUBUNGAN ANTARA HARGA DIRI DAN POLA ASUH DEMOKRATIS TERHADAP PERILAKU ASERTIF PADA SISWA SMK X. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Ulya, Himatul (2017) HUBUNGAN ANTARA KONFORMITAS DENGAN PERILAKU KONSUMTIF DALAM MEMODIFIKASI MOTOR OLEH ANGGOTA CLUB MOTOR. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Umam, Lutfi (2015) HUBUNGAN ANTARA PERILAKU MENYONTEK DENGAN KECENDERUNGAN KORUPSI PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Umaza Hasna, Irma (2022) DAMPAK FATHERLESS TERHADAP KONDISI EMOSI REMAJA KORBAN PERCERAIAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Ummah, Faizatul (2022) HUBUNGAN ANTARA GAYA KEPEMIMPINAN TRANSFORMASIONAL DAN KOMITMEN ORGANISASI PENGURUS PMII RAYON SAINS DAN TEKNOLOGI KOMISARIAT UIN WALISONGO SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Urip Dianta, Wah (2023) HUBUNGAN ANTARA MOTIVASI BERPRESTASI DENGAN KESIAPAN KERJA PADA MAHASISWA ANGKATAN 2018/2019 FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Utami, Putri Puji (2019) HUBUNGAN ANTARA MOTIVASI BERPRESTASI DAN RELASI TEMAN SEBAYA DENGAN KETIDAKJUJURAN AKADEMIK PADA MAHASISWA FAKULTAS X UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

V

Vegawati, Efrika Ayu (2017) RESILIENSI PADA MAHASISWI BERCADAR DI KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Verdiana, Risa Putri (2016) HUBUNGAN ANTARA SIKAP TERHADAPMODEL PERAN WIRAUSAHA DENGAN INTENSI BERWIRAUSAHA PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Violita, Putri Octa (2022) HUBUNGAN SELF-ESTEEM TERHADAP PERILAKU MENGKONSUMSI MINUMAN KERAS PADA PEMANDU KARAOKE DI MBEROK SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Virgian, Elgo Denisma (2021) HUBUNGAN ANTARA KEPERCAYAAN DIRI DENGAN KESIAPAN KERJA PADA MAHASISWA TINGKAT AKHIR DI FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Vitalonary, Hanni (2022) HUBUNGAN BURNOUT AKADEMIK DENGAN PROKRASTINASI AKADEMIK PADA MAHASISWA KULIAH ONLINE. Undergraduate thesis, Universitas Islam Sultan Agung.

W

WARDANI, ANGGI KUSUMA (2019) RESILIENSI PADA WANITA PASCA PENGANGKATAN RAHIM (HISTEREKTOMI) DI USIA PRODUKTIF (Studi Fenomenologi Resiliensi Wanita Usia Produktif). Undergraduate thesis, Universitas Islam Sultan Agung.

WIBOWO, BAGUS SATRIYO (2012) HUBUNGAN ANTARA EFIKASI DIRI DAN PERSEPSI TERHADAP TUNTUTAN KERJA DENGAN BURNOUT PADA PERAWAT RUMAH SAKIT ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

WIDYANTARI, OCTAVIA YUDHA (2022) KOGNISI MAHASISWA SELAMA PEMBELAJARAN DARING. Undergraduate thesis, Universitas Islam Sultan Agung.

WIDYANTI, FATIMAH CELIN (2022) HUBUNGAN ANTARA SELF EFFICACY DENGAN PENYESUAIAN AKADEMIK MELALUI SISTEM PEMBELAJARAN ONLINE DALAM SITUASI COVID-19 PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

WINANDA, ARIEF YURI (2011) HUBUNGAN ANTARA KONFORMITAS DENGAN KENAKALAN REMAJA DI SMA MUHAMMADIYAH PURWODADI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

WULANDARI, RITA CATUR (2004) HUBUNGAN ATARA STRES DENGAN PERSEPSI DUKUNGAN SOSIAL IBU PADA REMAJA DI SLTP NEGERI 5 SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Wachid, Umar Abdul (2021) HUBUNGAN KESEPIAN DENGAN KECENDERUNGAN PERILAKU KECANDUAN GAME ONLINE PADA SISWA MADRASAH TSANAWIYAH PUTRA MANBA’UL ULUM, GROBOGAN. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Wachida, Imroatul (2023) KEPERCAYAAN DIRI REMAJA DARI KABUPATEN MAGELANG DITINJAU DARI POLA ASUH ORANG TUA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Wahana, Salsa Elvira Putri (2023) HUBUNGAN ANTARA REGULASI DIRI DALAM BELAJAR DAN STRES AKADEMIK PADA SISWA KELAS XI SMK BHAKTI NUSANTARA MRANGGEN. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Wahdini, Radila Dwi (2023) HUBUNGAN ANTARA KEPERCAYAAN DIRI TERHADAP FEAR OF MISSING OUT (FOMO) PADA SISWA KELAS XI SMA ISLAM SULTAN AGUNG 01 SEMARANG TAHUN AJARAN 2022/2023. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Wahidah, Nur (2004) PERBEDAAN KEPUASAN KERJA DITINJA.U DARI TIPE KEPRIBADIAN KARY AWAN BAGIAN PRODUKSI PT TOSSA SHAKTI KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Wahyu Pradana, Angger (2022) HUBUNGAN ANTARA KONSEP DIRI DENGAN KEPERCAYAAN DIRI PADA SISWA SMK TAMANSISWA KUDUS. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Wahyudi, Wahyudi (2022) HUBUNGAN ANTARA RELIGIUSITAS DENGAN KOMITMEN ORGANISASI PADA SENAT MAHASISWA UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Wahyuni, Diah Ria Ayu (2021) HUBUNGAN ANTARA HARGA DIRI DENGAN PENGUNGKAPAN DIRI PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG PENGGUNA INSTAGRAM. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Wahyuningsih, Sri (2004) MOTIVASI BERPRESTASI DI TINJAU DARI KEPERCAYAAN DIRI PADA SISWA SMU NEGERI 1 KARANG TENGAH DEMAK. Undergraduate thesis, Universitas Islam Sultan Agung.

Wahyuningsih, Sri (2004) Motivasi Berprestasi Ditinjau dari Kepercayaan Diri pada Siswa SMU Negeri 1 Karang Tengah Demak. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Wahyuningtyas, Annita (2019) MENULIS EKSPRESIF UNTUK MENINGKATKAN KESEJAHTERAAN PSIKOLOGIS MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung.

Wangsit, Indah Fara (2023) HUBUNGAN ANTARA KESEPIAN DAN PRIVACY BEHAVIOR DENGAN PENGUNGKAPAN DIRI PADA DEWASA AWAL PENGGUNA FACEBOOK. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Wardani, Asminingtyas Retno (2016) KONSTRIBUSI PENERIMAAN PAJAK RESTORAN TERHADAP PENDAPATAN ASLI DAERAH KABUPATEN SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wardayani, Gisma Dian (2019) HUBUNGAN ANTARA POLA ASUH AUTORITATIF ORANG TUA DAN KONTROL DIRI DENGAN KECENDERUNGAN KECANDUAN GAME ONLINE PADA REMAJA DI SMPN 4 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Wardhani, Dewi Kusuma (2017) HUBUNGAN ANTARA KECEMASAN DENGAN PENYESUAIAN DIRI DALAM MENGHADAPI PENSIUN PADA APARATUR SIPIL NEGARA DI KEMENTERIAN BUMN BERDASARKAN JENIS KELAMIN. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wardhani, Maulina Kusuma (2017) TINJAUAN HUKUM TERHADAP PERJANJIAN KREDIT SEPEDA MOTOR DI PT. WAHANA OTTOMITRA MULTIARTHA (WOM) FINANCE WELERI KEC. WELERI KAB. KENDAL. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Warna, Tavip Kusuma (2020) HUBUNGAN ANTARA KOMPENSASI DENGAN KEPUASAN KERJA KARYAWAN PT. KARYA MINA PUTRA, REMBANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Warna, Tavip Kusuma (2019) HUBUNGAN ANTARA KOMPENSASI DENGAN KEPUASAN KERJA KARYAWAN PT. KARYA MINA PUTRA, REMBANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Waskitha, Bangkit Galih (2017) HUBUNGAN ANTARA STRES AKADEMIK DENGAN KECANDUAN SMARTPHONE PADA MAHASISWA FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wati, Laras Ambar (2020) HUBUNGAN ANTARA PERSEPSI TERHADAP BUDAYA DAERAH (JAWA) DENGAN MINAT KONSUMEN RESTORAN TRADISIONAL “JOGLO HILLS” SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Wati, Laras Ambar (2019) HUBUNGAN ANTARA PERSEPSI TERHADAP BUDAYA DAERAH (JAWA) DENGAN MINAT KONSUMEN RESTORAN TRADISIONAL “JOGLO HILLS” SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Wedhayanti, Gitta Citra (2017) HUBUNGAN KEPUASAN KERJA DAN PERSEPSI DUKUNGAN ORGANISASI TERHADAP ORGANIZATIONAL CITIZENSHIP BEHAVIOR DI PT. RECKITT BENCKISER INDONESIA, SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wibowo, Rifki Gusrian (2022) HUBUNGAN ANTARA DUKUNGAN SOSIAL PASANGAN DENGAN KECEMASAN PADA PELAKU USAHA MIKRO SEKTOR KULINER ANGKRINGAN DALAM MENGHADAPI MASA PPKM COVID-19 DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Wicaksono, Dimas Yekthi (2020) HUBUNGAN ANTARA MOTIVASI BERPRESTASI DENGAN KEJENUHAN PADA ANGGOTA CMB (COACH MELDY BASKETBALL) DI PUSAT PELATIHAN BASKET. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Wicaksono, Dimas Yekthi (2019) HUBUNGAN ANTARA MOTIVASI BERPRESTASI DENGAN KEJENUHAN PADA ANGGOTA CMB (COACH MELDY BASKETBALL) DI PUSAT PELATIHAN BASKET. Undergraduate thesis, Universitas Islam Sultan Agung.

Wicaksono, Muhammad Satrio (2021) HUBUNGAN ANTARA PENYESUAIAN AKADEMIK TERHADAP MOTIVASI BELAJAR SISWA SMAN 1 DEMAK DALAM MENGHADAPI SFH (School From Home) PADA MASA PANDEMI COVID19. Undergraduate thesis, Universitas Sultan Agung.

Widad, Khoirun Nisa’ Nurul (2020) HUBUNGAN ANTARA SELF-ESTEEM DENGAN PENYESUAIAN DIRI PADA MAHASISWA FAKULTAS PSIKOLOGI UNISSULA. Undergraduate thesis, Universitas Islam Sultan Agung.

Widad, Widya Qorinnatul (2023) HUBUNGAN ANTARA GAYA KEPEMIMPINAN TRANSFORMASIONAL DAN PERSEPSI KEADILAN KOMPENSASI TERHADAP LOYALITAS KARYAWAN PT. KRIDHA MULTINIAGA PRIMA JUWANA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Widiantari, Devinta Putri (2021) HUBUNGAN ANTARA DUKUNGAN SOSIAL DENGAN MOTIVASI BERPRESTASI SISWA SMP IT PAPB SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Widijatmiko, St. Novensius Cahyo (2019) HUBUNGAN ANTARA KEPUASAN KERJA DENGAN TURNOVER INTENTION PADA KARYAWAN LABORATORIUM DI RS. “X” DI SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Widiyanti, Cut Meuthia (2018) HUBUNGAN ANTARA HARGA DIRI DAN MATERIALISME DENGAN COMPULSIVE BUYING PADA REMAJA DI SMA X SEMARANG. Undergraduate thesis, Fakultas Ekonomi UNISSULA.

Widiyanto, Oktavianisa Salsabilla Putri (2023) HUBUNGAN ANTARA KONTROL DIRI DENGAN PERILAKU PROKRASTINASI AKADEMIK PADA MAHASISWA AKHIR FAKULTAS PSIKOLOGI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Widodo, Agus (2017) HUBUNGAN ANTARA PAHAM HETEROSEKSUAL DAN MASKULINITAS DENGAN HOMOFOBIA PADA SANTRI PONDOK PESANTREN DAERAH X KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Widodo, Muhammad Mansyur (2014) HUBUNGAN ANTARA ORIENTASI DOMINASI SOSIAL (ODS) DENGAN PERILAKU BULLYING PADA SISWI SMA DAN SMK DI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Widya, Qory Kemala Glady’s (2022) HUBUNGAN ANTARA KEPERCAYAAN DIRI DAN DUKUNGAN ORANG TUA DENGAN MOTIVASI BERWIRAUSAHA PADA MAHASISWA. Undergraduate thesis, Universitas Islam Sultan Agung.

Widyaninggar, Rizki Yuliani (2019) HUBUNGAN ANTARA PENERIMAAN DIRI DAN KONSEP DIRI DENGAN KEBERMAKNAAN HIDUP NARAPIDANA WANITA. Undergraduate thesis, Universitas Islam Sultan Agung.

Widyaninggar, Rizki Yuliani (2020) HUBUNGAN ANTARA PENERIMAAN DIRI DAN KONSEP DIRI DENGAN KEBERMAKNAAN HIDUP NARAPIDANA WANITA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Widyaningsih, Erni (2016) HUBUNGAN ANTARA PERSEPSI TERHADAP KEKERASAN VERBAL ORANG TUA DENGAN KONSEP DIRI PADA REMAJA DI SMA N2 BATANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wigati, Woro Ayu (2017) HUBUNGAN ANTARA HARGA DIRI DENGAN PERILAKU AGRESIF PADA REMAJA SUKU KOMERING DI DESA “X” KABUPATEN OGAN KOMERING ULU TIMUR (OKUT). Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wijaya, Nurul (2016) HUBUNGAN ANTARA MINAT TERHADAP BUDAYA KOREA DAN KONFORMITAS DENGAN PERILAKU KONSUMTIF DALAM MEMBELI PRODUK KOREA PADA KOMUNITAS SAHABAT KOREAN DRAMA LOVERS (SKDL) SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wijaya, Wahyu Candra (2022) HUBUNGAN ANTARA ALEXITYMIA DENGAN PERILAKU CYBERBULLYING PADA SISWA DI SMA SULTAN AGUNG 1 SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Wijayanti, Nurlita (2020) PENGARUH SIKAP RELIGIUS TERHADAP KOPING RELIGIUS PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG (UNISSULA) SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Wijayanti, Nurlita (2019) Pengaruh Sikap Religius Terhadap Koping Religius Pada Mahasiswa Universitas Islam Sultan Agung (UNISSULA) Semarang. Undergraduate thesis, Universitas Islam Sultan Agung.

Wijayanti, Yuliana Eka Putri (2016) HUBUNGAN ANTARA KELAS SOSIAL EKONOMI DAN KEMATANGAN EMOSI DENGAN KECENDERUNGAN MENIKAH MUDA PADA SISWI SMK IBU KARTINI KOTA SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wijonarko, Alvian (2016) EVALUASI SISTEM PENGENDALIAN INTERN TERHADAP PEMBERIAN KREDIT PADA KSP CIPTA ARTHA BERSAMA 346. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wilandari, Jefriyani MujiAsih (2020) HUBUNGAN ANTARA KEPERCAYAAN DIRI DAN DUKUNGAN SOSIAL GURU TERHADAP PRESTASI BELAJAR PRAKTIKUM FARMAKOGNOSI SISWA KELAS XI DI SMK X SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Winarno, Winarno (2015) HUBUNGAN ANTARA KONTROL DIRI DENGAN PERILAKU MINUM MINUMAN KERAS PADA REMAJA DI DESA TURIREJO KABUPATEN DEMAK. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wiranto, Joko (2023) HUBUNGAN PEMBELIAN COMPULSIVE DAN LITERASI KEUANGAN ISLAM DENGAN KECENDERUNGAN BERHUTANG SHOPEE PAYLATER PADA MAHASISWA UNIVERITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Wiraputra, Dimas Catur (2022) HUBUNGAN ANTARA KECERDASAN EMOSI DENGAN PERILAKU MENGEMUDI BERISIKO PADA DRIVER OJEK ONLINE DI KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Wisaksono, Agil S (2022) HUBUNGAN ANTARA NEED FOR POWER TERHADAP PERILAKU CYBERBULLYING PADA REMAJA SMA N 1 BOJA. Undergraduate thesis, Universitas Islam Sultan Agung.

Wulandari, Aghnis Mustamila (2017) HUBUNGAN ANTARA KUALITAS PELAYANAN DENGAN KEPUASAN KONSUMEN PADA PEMBELIAN HIJAB ONLINE MAHASISWI ANGKATAN 2014-2015 & 2015-2016 UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wulandari, Kartika (2017) HUBUNGAN ANTARA MOTIVASI BERPRESTASI DAN KOHESIVITAS KELOMPOK DENGAN KEMALASAN SOSIAL PADA MAHASISWA SEMESTER V UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Wulandari, Renita Sari (2023) HUBUNGAN ANTARA KONTROL DIRI DENGAN PERILAKU UJARAN KEBENCIAN PENGGUNA INSTAGRAM PADA SISWA DI SMA X. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Wulansari, Gita Hening (2019) HUBUNGAN ANTARA GAYA HIDUP HEDONIS DENGAN PERILAKU KONSUMTIF MEMBELI MAKE UP PADA MAHASISWI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Y

YULNUGRAHENI R, ANGGERAYU (2012) HUBUNGAN ANTARA PERILAKU BERTATO DENGAN KEPERCAYAAN DIRI PADA WANITA DEWASA AWAL YANG BERTATO DI KOTA SALATIGA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

YUNIAR, DEVI YOLA (2022) HUBUNGAN KELEKATAN ORANG TUA DENGAN KECERDASAN EMOSIONAL PADA REMAJA. Undergraduate thesis, Universitas Islam Sultan Agung.

Yanti, Dewi (2016) HUBUNGAN KONFORMITAS DAN PERILAKU KONSUMTIF PADA ISTRI KARYAWAN PT. X SULAWESI TENGGARA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Yanti, Sintiya Rahmah (2023) HUBUNGAN OPTIMISME DAN KECEMASAN DALAM MENGHADAPI DUNIA KERJA PADA SISWA KELAS XII SMKN 1 PAKISJAYA KARAWANG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Yasmin, Gerrina (2021) HUBUNGAN ANTARA EMOSI POSITIF DENGAN PRODUKTIVITAS KERJA KARYAWAN WANITA DI PT AHMADARIS KABUPATEN TEGAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Yohania, Weli (2014) STUDI FENOMENOLOGI DAMPAK PSIKOLOGIS KORBAN KEKERASAN SEKSUAL PADA SANTRIWATI PONDOK PESANTREN X. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Yosefa, Puja Bela (2021) HUBUNGAN ANTARA KOMITMEN ORGANISASI DENGAN SERVANT LEADERSHIP PADA KETUA ORGANISASI DI UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Yovana, Nagesta Mayke Heryan (2021) HUBUNGAN KONTROL DIRI DENGAN PERILAKU CYBERSEX PADA REMAJA DI SMA X KOTA KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Yudiyaputra, Muhammad Brilliant (2023) HUBUNGAN ANTARA REGULASI EMOSI DENGAN PERSEPSI TERHADAP PERILAKU SELF-INJURY PADA SISWA SMP NEGERI 1 JATIWANGI. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Yudiyasiwi, Feslika Rezki (2020) HUBUNGAN PERSEPSI TERHADAP KEHARMONISAN KELUARGA DAN KESTABILAN EMOSI DENGAN PERILAKU AGRESIF PADA REMAJA DI SMP NEGERI 2 JATIWANGI. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Yuliana, Atika Fitri (2023) HUBUNGAN ANTARA DETERMINASI DIRI DAN PERSEPSI TERHADAP HARAPAN ORANG TUA DENGAN PENGAMBILAN KEPUTUSAN KARIER SISWA KELAS XII DI SMK MA’ARIF NU 01 LIMPUNG. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Yuliana, Rizky Putri (2021) HUBUNGAN ANTARA INTENSITAS MENONTON VIDEO EKSPERIMEN SOSIAL DENGAN PERILAKU PROSOSIAL PADA REMAJA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Yuliani, Dyah Wulan (2022) HUBUNGAN ANTARA KAPABILITAS TEKNOLOGI INFORMASI DENGAN MOTIVASI BELAJAR PADA MAHASISWA UNIVERSITAS ISLAM SULTAN AGUNG SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Yulianti, Dinda (2020) PENGARUH STRES KERJA DAN BEBAN KERJA TERHADAP KINERJA KARYAWAN PT. T I (PERSERO) WITEL SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Yuliyanti, Erni Dwi (2021) HUBUNGAN ANTARA PERSEPSI TERHADAP KEMATIAN DENGAN KECEMASAN MENGHADAPI KEMATIAN PADA LANJUT USIA. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Yulya, Tri Prapti (2015) HUBUNGAN ANTARA MOTIVASI BELAJAR DENGAN PRESTASI BELAJAR PADA MAHASISWA YANG KECANDUAN BERMAIN GAME ONLINE DI FAKULTAS TEKNOLOGI INDUSTRI UNISSULA. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Yunan Vonda Octavian, Yunan Vonda (2010) Perbedaan Stress Kerja Ditinjau dari Masa Kerja dan Jenis Kelamin pada Karyawan Hotel dan Restoran Suzana Baru Tegal. Undergraduate thesis, Fakultas Psikologi Unissula.

Yunistya, Tasya (2023) HUBUNGAN ANTARA KONTROL DIRI DAN ACADEMIC BURNOUT TERHADAP PERILAKU CYBERSLACKING PADA SISWA DI SMK X. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Yusifa, Rula (2023) HUBUNGAN ANTARA KONTROL DIRI DENGAN AGRESIVITAS PADA PARA MANTAN PENGGUNA NARKOBA. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Yussanti, Yussanti (2017) DAMPAK PSIKOLOGIS PADA ISTRI YANG MENGALAMI PERSELINGKUHAN SUAMI. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Yusuf, Andri Firdiana (2020) HUBUNGAN ANTARA KONFORMITAS DENGAN PERILAKU AGRESIF SISWA SMP NEGERI “X” DI KABUPATEN SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Z

Zaen, Amira Hasna Noor (2023) HUBUNGAN ANTARA KELEKATAN ORANGTUA DAN ANAK SERTA HARGA DIRI DENGAN KESEPIAN PADA SISWA SMPN 2 TEGAL. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Zahraningsih, Ichdha Sausan (2019) HUBUNGAN ANTARA KONTROL DIRI DAN KONFORMITAS DENGAN PROKRASTINASI AKADEMIK PADA SISWA SMA ISLAM SULTAN AGUNG 3 KOTA SEMARANG. Undergraduate thesis, Universitas Islam Sultan Agung.

Zahro’ Nur, Auliya (2022) HUBUNGAN ANTARA KEMANDIRIAN DAN PENYESUAIAN DIRI PADA SANTRI PUTRI DI PONDOK PESANTREN SUNAN KALIJOGO PATEBON KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Zaky, Shamia Elza (2023) HUBUNGAN ANTARA DUKUNGAN SOSIAL TEMAN SEBAYA DENGAN EFIKASI DIRI PADA MAHASISWA AKHIR. Undergraduate thesis, UNIVERSITAS ISLAM SULTAN AGUNG.

Zikrinawati, Khairani (2014) STUDI KASUS KARAKTERISTIK KEPRIBADIAN SOCIAL ENTREPRENEUR DI JAWA TENGAH. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Zulfa, Naily Mazaya (2016) PROSES KEBERMAKNAAN HIDUP PADA WANITA PEKERJA SEKS KOMERSIAL (PSK) DI SEMARANG. Undergraduate thesis, Fakultas Psikologi UNISSULA.

Zulfa, Nur Roihana (2022) HUBUNGAN ANTARA SELF EFFICACY DAN DUKUNGAN SOSIAL KELUARGA DENGAN KECEMASAN MAHASISWA TINGKAT AKHIR. Undergraduate thesis, Universitas Islam Sultan Agung.

Zulfania, Arifda (2023) HUBUNGAN ANTARA PENYESUAIAN DIRI DENGAN KECEMASAN DALAM MENGHADAPI MASA PENSIUN PADA PEGAWAI PERHUTANI DI KABUPATEN KENDAL. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

Zulqornain, Achmad Adib (2020) HUBUNGAN ANTARA EFIKASI DIRI DAN DUKUNGAN SOSIAL TEMAN SEBAYA TERHADAP KECEMASAN MAHASISWA BERBICARA DI DEPAN UMUM. Undergraduate thesis, Universitas Islam Sultan Agung Semarang.

This list was generated on Thu Feb 22 05:33:42 2024 UTC.